Alexa Top 753001 – 753500 Most Visited Websites – Most Popular Sites List 2022

Based on data from the Alexa rank, this page reveals the Alexa Top 753001 – 753500 most visited websites. We will be updating this list daily, so you can keep track of all the market shifts and spot changes in user interest.

megateh.eu is the top 753001 – 753500 most visited website in the world in 03/12/2022, who’s rank stayed the same, while the second-placed meinbergglobal.com stayed the same in the same period. meine-renditeimmobilie.de also performed well.

Depending on the methodology used, the results can have significant variability. However, having a reasonably accurate list is beneficial to the many use cases these lists can be applied to.

Alexa Top 753001 – 753500 Domain List

Alexa Top 753001 – 753500 Websites Ranking data updated according to the most recent updated in 03/12/2022.

Rank Domain Yesterday Last week Last month Last year
753001 Icon of megateh.eumegateh.eu

760792 (+7791)

502402 (-250599)

585659 (-167342)

753002 Icon of meinbergglobal.commeinbergglobal.com

508965 (-244037)

371680 (-381322)

753003 Icon of meine-renditeimmobilie.demeine-renditeimmobilie.de
753004 Icon of meipian.memeipian.me

47026 (-705978)

753005 Icon of meiwoscience.commeiwoscience.com
753006 Icon of mejeri.dkmejeri.dk
753007 Icon of mekoprint.commekoprint.com

202234 (-550773)

753008 Icon of meldmerge.orgmeldmerge.org

649163 (-103845)

209813 (-543195)

753009 Icon of melholt.numelholt.nu

660433 (-92576)

753010 Icon of melonsclips.commelonsclips.com

145077 (-607933)

753011 Icon of membantu.dkmembantu.dk
753012 Icon of memberlink.dkmemberlink.dk

780510 (+27498)

753013 Icon of memira.dkmemira.dk

717368 (-35645)

660439 (-92574)

604607 (-148406)

753014 Icon of mendhak.commendhak.com

501709 (-251305)

301015 (-451999)

753015 Icon of menighedsraad.dkmenighedsraad.dk

591736 (-161279)

710280 (-42735)

753016 Icon of mensclassics.dkmensclassics.dk
753017 Icon of mentech.dkmentech.dk

660443 (-92574)

753018 Icon of menuen.dkmenuen.dk

780520 (+27502)

753019 Icon of menyhorsens.dkmenyhorsens.dk

780522 (+27503)

660447 (-92572)

732334 (-20685)

753020 Icon of mercantec.dkmercantec.dk

764758 (+11738)

635157 (-117863)

732337 (-20683)

753021 Icon of mereteb.dkmereteb.dk

660448 (-92573)

753022 Icon of merjul.numerjul.nu
753023 Icon of merkazliberaly.co.ilmerkazliberaly.co.il

764759 (+11736)

753024 Icon of merlin.dkmerlin.dk

697250 (-55774)

508023 (-245001)

726050 (-26974)

753025 Icon of meroyoga.commeroyoga.com

660450 (-92575)

753026 Icon of mersd.orgmersd.org
753027 Icon of mesonstars.commesonstars.com

457645 (-295382)

753028 Icon of mesterbold.dkmesterbold.dk

780529 (+27501)

607926 (-145102)

684501 (-68527)

753029 Icon of metador.commetador.com
753030 Icon of metalbondnyc.commetalbondnyc.com

294103 (-458927)

282074 (-470956)

753031 Icon of metalwo.dkmetalwo.dk
753032 Icon of metartgalleries.netmetartgalleries.net
753033 Icon of metartmagazine.commetartmagazine.com
753034 Icon of meteogroup.commeteogroup.com

780532 (+27498)

753035 Icon of meteor.dkmeteor.dk
753036 Icon of methodsformale.lifemethodsformale.life

249665 (-503371)

753037 Icon of metodecentret.dkmetodecentret.dk
753038 Icon of metrimo.iometrimo.io
753039 Icon of metropolia-motorsport.netmetropolia-motorsport.net
753040 Icon of metteblomsterberg.commetteblomsterberg.com

780538 (+27498)

551767 (-201273)

753041 Icon of mettesigernej.dkmettesigernej.dk

713035 (-40006)

753042 Icon of metz.dkmetz.dk

551555 (-201487)

486067 (-266975)

753043 Icon of mf-consulting.atmf-consulting.at
753044 Icon of mf-gym.dkmf-gym.dk
753045 Icon of mgcc.dkmgcc.dk
753046 Icon of mgmboats.commgmboats.com

764760 (+11714)

753047 Icon of mgmotors.dkmgmotors.dk

713036 (-40011)

706397 (-46650)

753048 Icon of mhktricks.orgmhktricks.org

649215 (-103833)

753049 Icon of miac.org.ukmiac.org.uk
753050 Icon of miafoelbaek.dkmiafoelbaek.dk
753051 Icon of miassnews.rumiassnews.ru

111509 (-641542)

643487 (-109564)

753052 Icon of mibitequus.dkmibitequus.dk

780549 (+27497)

732363 (-20689)

753053 Icon of microban.commicroban.com

436944 (-316109)

753054 Icon of microdoser.dkmicrodoser.dk
753055 Icon of microscopyu.commicroscopyu.com

569060 (-183995)

496588 (-256467)

261659 (-491396)

753056 Icon of micul-fermier.romicul-fermier.ro

722601 (-30455)

753057 Icon of midgaardshave.dkmidgaardshave.dk

660470 (-92587)

753058 Icon of midpar.dkmidpar.dk
753059 Icon of midtjob.dkmidtjob.dk

699824 (-53235)

539067 (-213992)

753060 Icon of mihoci.commihoci.com
753061 Icon of mikkelsentoftlund.dkmikkelsentoftlund.dk
753062 Icon of mikogmak.dkmikogmak.dk
753063 Icon of milf-book.commilf-book.com

652173 (-100890)

615373 (-137690)

753064 Icon of milfspics.commilfspics.com

496011 (-257053)

753065 Icon of milhidaka.github.iomilhidaka.github.io

268505 (-484560)

753066 Icon of military1st.dkmilitary1st.dk

617757 (-135309)

753067 Icon of militarysurplus.eumilitarysurplus.eu

618976 (-134091)

588977 (-164090)

753068 Icon of militarysurplus.humilitarysurplus.hu

569270 (-183798)

301025 (-452043)

753069 Icon of miljovernfondet.nomiljovernfondet.no
753070 Icon of milkio.co.nzmilkio.co.nz

785812 (+32742)

453251 (-299819)

546929 (-206141)

129538 (-623532)

753071 Icon of millinghotels.dkmillinghotels.dk

756793 (+3722)

726058 (-27013)

753072 Icon of milliontobillion.commilliontobillion.com

249731 (-503341)

261797 (-491275)

753073 Icon of milolydogbillede.dkmilolydogbillede.dk

702444 (-50629)

660489 (-92584)

732393 (-20680)

753074 Icon of miltonhuse.dkmiltonhuse.dk
753075 Icon of mime.newsmime.news

683886 (-69189)

753076 Icon of mimocosmetics.eumimocosmetics.eu
753077 Icon of mindedge.commindedge.com

374392 (-378685)

107872 (-645205)

753078 Icon of mindfood.shopmindfood.shop

617758 (-135320)

753079 Icon of mindfulife.demindfulife.de
753080 Icon of mindjuice.commindjuice.com
753081 Icon of mindstepcare.commindstepcare.com

775216 (+22135)

706061 (-47020)

753082 Icon of mindwork.dkmindwork.dk
753083 Icon of minecraft-guides.comminecraft-guides.com

628683 (-124400)

753084 Icon of minecraftlist.dkminecraftlist.dk

699023 (-54061)

660501 (-92583)

732404 (-20680)

753085 Icon of minenergi2.dkminenergi2.dk
753086 Icon of minfiber.dkminfiber.dk
753087 Icon of minforsendelse.dkminforsendelse.dk
753088 Icon of miniatur-wunderland.comminiatur-wunderland.com

360018 (-393070)

753089 Icon of minifinans.dkminifinans.dk

780594 (+27505)

660505 (-92584)

753090 Icon of minimalist-me.comminimalist-me.com
753091 Icon of minip.dkminip.dk

585638 (-167453)

615826 (-137265)

753092 Icon of minizoo.dkminizoo.dk
753093 Icon of minmincph.dkminmincph.dk

604181 (-148912)

753094 Icon of minnieandmary.comminnieandmary.com
753095 Icon of minnshu.comminnshu.com

74197 (-678898)

96463 (-656632)

753096 Icon of minttujaville.fiminttujaville.fi
753097 Icon of minuteman1636.webs.comminuteman1636.webs.com
753098 Icon of mipc.camipc.ca
753099 Icon of mipcm.commipcm.com

380967 (-372132)

753100 Icon of miraclecloth-denmark.commiraclecloth-denmark.com
753101 Icon of miriadna.commiriadna.com
753102 Icon of missing-lynx.commissing-lynx.com
753103 Icon of missions.zipmissions.zip
753104 Icon of mistressamandara.commistressamandara.com
753105 Icon of mitchellt.commitchellt.com
753106 Icon of mitdrikkevand.dkmitdrikkevand.dk
753107 Icon of mitiba.dkmitiba.dk
753108 Icon of mitrejsevejr.dkmitrejsevejr.dk

780616 (+27508)

753109 Icon of mitrestorres.commitrestorres.com
753110 Icon of mitula.dkmitula.dk

641630 (-111480)

674956 (-78154)

753111 Icon of mixana.commixana.com
753112 Icon of mizar.com.hkmizar.com.hk
753113 Icon of mizumisushi.dkmizumisushi.dk
753114 Icon of mjolner.dkmjolner.dk

660523 (-92591)

753115 Icon of mkang32.github.iomkang32.github.io
753116 Icon of mknorth.dkmknorth.dk
753117 Icon of mkorostoff.github.iomkorostoff.github.io

569667 (-183450)

90139 (-662978)

547289 (-205828)

753118 Icon of mlaw.dkmlaw.dk
753119 Icon of mmaction.dkmmaction.dk

654543 (-98576)

753120 Icon of mob-platform.eumob-platform.eu
753121 Icon of mobileagencyapps.commobileagencyapps.com
753122 Icon of mobilelegendsbuild.commobilelegendsbuild.com

725156 (-27966)

753123 Icon of mobilesuit.msmobilesuit.ms
753124 Icon of mobilize-me.commobilize-me.com
753125 Icon of mobilretshjaelp.dkmobilretshjaelp.dk
753126 Icon of mod-portal.commod-portal.com
753127 Icon of modelflyvningdanmark.dkmodelflyvningdanmark.dk
753128 Icon of moderndesign.orgmoderndesign.org
753129 Icon of modernroom.dkmodernroom.dk
753130 Icon of modersmaalselskabet.dkmodersmaalselskabet.dk

764764 (+11634)

753131 Icon of modifikasi.commodifikasi.com

649307 (-103824)

195843 (-557288)

418313 (-334818)

753132 Icon of modusfinans.dkmodusfinans.dk
753133 Icon of modvaekst.dkmodvaekst.dk
753134 Icon of moedrehjaelpen.dkmoedrehjaelpen.dk

574650 (-178484)

717409 (-35725)

753135 Icon of moidogames.commoidogames.com
753136 Icon of molslaegerne.dkmolslaegerne.dk
753137 Icon of momentstudio.dkmomentstudio.dk
753138 Icon of momidliketofuck.netmomidliketofuck.net

570014 (-183124)

753139 Icon of momporngallery.commomporngallery.com
753140 Icon of momtestbook.commomtestbook.com

570049 (-183091)

491808 (-261332)

642190 (-110950)

753141 Icon of monacoeye.commonacoeye.com
753142 Icon of monashmotorsport.commonashmotorsport.com
753143 Icon of monsieurz-zielenkiewicz.blogspot.commonsieurz-zielenkiewicz.blogspot.com
753144 Icon of monsterbashpincab.commonsterbashpincab.com
753145 Icon of monstermarket.iomonstermarket.io

421068 (-332077)

753146 Icon of monsterwatches.eumonsterwatches.eu
753147 Icon of montableaudeco.commontableaudeco.com
753148 Icon of moodeaudio.orgmoodeaudio.org

589307 (-163841)

753149 Icon of morbarn.infomorbarn.info
753150 Icon of more-eliza.commore-eliza.com

780682 (+27532)

584972 (-168178)

434849 (-318301)

753151 Icon of morefut.commorefut.com

192298 (-560853)

122796 (-630355)

753152 Icon of morenaturalwine.commorenaturalwine.com
753153 Icon of moreteasir.eumoreteasir.eu
753154 Icon of morethangreen.esmorethangreen.es

780685 (+27531)

753155 Icon of moriteam.commoriteam.com
753156 Icon of morningtrain.dkmorningtrain.dk
753157 Icon of mors.dkmors.dk

780690 (+27533)

753158 Icon of morshed-bdc.commorshed-bdc.com
753159 Icon of morsskole.sharepoint.commorsskole.sharepoint.com
753160 Icon of morud.dkmorud.dk
753161 Icon of mosancocafe.commosancocafe.com

780696 (+27535)

753162 Icon of moscowdailynews.rumoscowdailynews.ru

141220 (-611942)

753163 Icon of mosmadhus.dkmosmadhus.dk
753164 Icon of motherlodesimsww.wordpress.commotherlodesimsww.wordpress.com

769218 (+16054)

453932 (-299232)

753165 Icon of motil.commotil.com
753166 Icon of motion-online.dkmotion-online.dk

717411 (-35755)

753167 Icon of moto.demoto.de
753168 Icon of motom.commotom.com
753169 Icon of motorbaadsnyt.dkmotorbaadsnyt.dk
753170 Icon of motorsamlingen.dkmotorsamlingen.dk
753171 Icon of motoxpricambi.commotoxpricambi.com

293201 (-459970)

753172 Icon of moujamoon.commoujamoon.com
753173 Icon of moumou.dkmoumou.dk

775243 (+22070)

631748 (-121425)

717414 (-35759)

753174 Icon of mousemods.usmousemods.us

780702 (+27528)

753175 Icon of movementlab.dkmovementlab.dk
753176 Icon of movemusic.iomovemusic.io
753177 Icon of moviehousememories.commoviehousememories.com
753178 Icon of moviezoo.dkmoviezoo.dk

607936 (-145242)

753179 Icon of movingtalent.eumovingtalent.eu
753180 Icon of moxymgt.commoxymgt.com

780705 (+27525)

338947 (-414233)

753181 Icon of moznostvolby.skmoznostvolby.sk
753182 Icon of mp4moviez.lovemp4moviez.love

780706 (+27524)

732486 (-20696)

73732 (-679450)

753183 Icon of mpoweruk.commpoweruk.com

224533 (-528650)

753184 Icon of mpro.dempro.de
753185 Icon of mpvfinpo.dkmpvfinpo.dk
753186 Icon of mrchowliquorstore.commrchowliquorstore.com

275976 (-477210)

753187 Icon of mri-q.commri-q.com
753188 Icon of mrperfect.dkmrperfect.dk

780711 (+27523)

631749 (-121439)

660219 (-92969)

753189 Icon of mrrhexx.shopmrrhexx.shop
753190 Icon of ms-cloudlabs.aims-cloudlabs.ai

780713 (+27523)

753191 Icon of msclusters.commsclusters.com
753192 Icon of msd-animal-health.commsd-animal-health.com

576628 (-176564)

753193 Icon of msd-animal-health.dkmsd-animal-health.dk
753194 Icon of msf.dkmsf.dk

732491 (-20703)

753195 Icon of msfsaddon.commsfsaddon.com

702821 (-50374)

677310 (-75885)

753196 Icon of msfyrholm.dkmsfyrholm.dk
753197 Icon of msgconv.commsgconv.com
753198 Icon of mshop.dkmshop.dk

595983 (-157215)

753199 Icon of msmvps.commsmvps.com

495448 (-257751)

412771 (-340428)

436953 (-316246)

753200 Icon of msnjournals.commsnjournals.com
753201 Icon of msnoise.orgmsnoise.org
753202 Icon of msp-tuning.dkmsp-tuning.dk

780716 (+27514)

753203 Icon of mspcdns.commspcdns.com

257713 (-495490)

548254 (-204949)

753204 Icon of mtb-tours.dkmtb-tours.dk
753205 Icon of mudan.dkmudan.dk
753206 Icon of mukuu.herokuapp.commukuu.herokuapp.com

146771 (-606435)

753207 Icon of mumu-net.commumu-net.com

671855 (-81352)

753208 Icon of munch-skagen.dkmunch-skagen.dk
753209 Icon of mundheld.dkmundheld.dk
753210 Icon of munkstore.dkmunkstore.dk

486176 (-267034)

676839 (-76371)

753211 Icon of mur-tag.dkmur-tag.dk
753212 Icon of museumscafe.dkmuseumscafe.dk
753213 Icon of musiccityaarhus2022.dkmusiccityaarhus2022.dk
753214 Icon of musicdigi.commusicdigi.com

480902 (-272312)

753215 Icon of musikbranchen.dkmusikbranchen.dk
753216 Icon of muslimcentral.commuslimcentral.com

656412 (-96804)

609708 (-143508)

753217 Icon of musterbrand.commusterbrand.com
753218 Icon of muzoo.iomuzoo.io
753219 Icon of my-metal-arts.myshopify.commy-metal-arts.myshopify.com

571101 (-182118)

660608 (-92611)

753220 Icon of my-summer-adventure.commy-summer-adventure.com

363677 (-389543)

753221 Icon of my3.atmy3.at
753222 Icon of my3.aumy3.au
753223 Icon of myballs.dkmyballs.dk
753224 Icon of mybiggaytpg.commybiggaytpg.com
753225 Icon of mycommerce360.dkmycommerce360.dk
753226 Icon of mydailyspace.dkmydailyspace.dk

684515 (-68711)

753227 Icon of mydesk.dkmydesk.dk
753228 Icon of mydinners.dkmydinners.dk

660617 (-92611)

753229 Icon of mydress.commydress.com
753230 Icon of myeyes.dkmyeyes.dk
753231 Icon of myfittingroom.dkmyfittingroom.dk

612368 (-140863)

753232 Icon of myflixer.lifemyflixer.life

138792 (-614440)

192930 (-560302)

319526 (-433706)

85503 (-667729)

753233 Icon of myfunzy.commyfunzy.com

733647 (-19586)

668942 (-84291)

753234 Icon of mygeolocate.commygeolocate.com
753235 Icon of mygothia.dkmygothia.dk
753236 Icon of myheatpump.commyheatpump.com

780747 (+27511)

660626 (-92610)

467640 (-285596)

753237 Icon of mykeyspro.commykeyspro.com

775257 (+22020)

645521 (-107716)

717420 (-35817)

753238 Icon of myloan.linkmyloan.link
753239 Icon of mymarq.commymarq.com
753240 Icon of mynatus.sharepoint.commynatus.sharepoint.com

780752 (+27512)

660628 (-92612)

732521 (-20719)

753241 Icon of mynetdeal.dkmynetdeal.dk

706855 (-46386)

753242 Icon of myogholger.dkmyogholger.dk

775259 (+22017)

753243 Icon of mypagerank.netmypagerank.net

143916 (-609327)

127548 (-625695)

120569 (-632674)

42047 (-711196)

753244 Icon of myresearch.dkmyresearch.dk
753245 Icon of myrkdalen-camping.nomyrkdalen-camping.no
753246 Icon of mysexymatures.commysexymatures.com

384738 (-368508)

623307 (-129939)

753247 Icon of mysislovesme.commysislovesme.com

387812 (-365435)

98877 (-654370)

374753 (-378494)

753248 Icon of myskin.dkmyskin.dk
753249 Icon of mysnap.topmysnap.top

126584 (-626665)

753250 Icon of mysticbusinessschool.commysticbusinessschool.com

721641 (-31609)

458440 (-294810)

753251 Icon of mysugarfreekitchen.commysugarfreekitchen.com

628929 (-124322)

753252 Icon of mythopedia.commythopedia.com

312257 (-440995)

454794 (-298458)

624855 (-128397)

753253 Icon of mytv-gold.commytv-gold.com
753254 Icon of mytv-storm.commytv-storm.com
753255 Icon of myvarian.commyvarian.com

732531 (-20724)

753256 Icon of myvolts.co.ukmyvolts.co.uk
753257 Icon of mywebar.commywebar.com

184100 (-569157)

230562 (-522695)

157799 (-595458)

753258 Icon of mywifeporn.commywifeporn.com

263404 (-489854)

753259 Icon of nadadventist.orgnadadventist.org

549270 (-203989)

753260 Icon of naervaer.dknaervaer.dk
753261 Icon of naestvederhverv.dknaestvederhverv.dk
753262 Icon of naestvederhvervsforening.dknaestvederhvervsforening.dk
753263 Icon of naestvednetavis.dknaestvednetavis.dk
753264 Icon of naestvedstorcenter.dknaestvedstorcenter.dk

597889 (-155375)

753265 Icon of nage.dknage.dk

710288 (-42977)

753266 Icon of nagejul.dknagejul.dk
753267 Icon of nageshop.dknageshop.dk
753268 Icon of nagoya.dknagoya.dk

670678 (-82590)

732537 (-20731)

753269 Icon of nail4you.dknail4you.dk
753270 Icon of nakedmilf.netnakedmilf.net

780773 (+27503)

454876 (-298394)

753271 Icon of nakedoldladies.netnakedoldladies.net

496018 (-257253)

454879 (-298392)

753272 Icon of nakedwanderings.comnakedwanderings.com

431121 (-322151)

660650 (-92622)

339040 (-414232)

753273 Icon of nalox.dknalox.dk
753274 Icon of namehenkan.comnamehenkan.com

193920 (-559354)

305876 (-447398)

303109 (-450165)

753275 Icon of napolipizzagram.dknapolipizzagram.dk

736556 (-16719)

660654 (-92621)

753276 Icon of narkotester.dknarkotester.dk
753277 Icon of naryan-marnews.runaryan-marnews.ru

780779 (+27502)

606530 (-146747)

753278 Icon of nas-forum.comnas-forum.com

352480 (-400798)

589268 (-164010)

753279 Icon of natalieshealth.comnatalieshealth.com

398188 (-355091)

549452 (-203827)

232806 (-520473)

753280 Icon of nathayogacenter.comnathayogacenter.com
753281 Icon of nationaltcenterforetik.dknationaltcenterforetik.dk
753282 Icon of native-track.comnative-track.com

649490 (-103792)

138462 (-614820)

753283 Icon of natmus.sharepoint.comnatmus.sharepoint.com

780783 (+27500)

660662 (-92621)

753284 Icon of naturbutikken.dknaturbutikken.dk
753285 Icon of nature4climate.orgnature4climate.org
753286 Icon of naturepositive.orgnaturepositive.org

448925 (-304361)

753287 Icon of naturespocket.comnaturespocket.com

780788 (+27501)

654163 (-99124)

732547 (-20740)

753288 Icon of naturfamilier.dknaturfamilier.dk

660666 (-92622)

753289 Icon of naturheilmagazin.denaturheilmagazin.de
753290 Icon of naturist-fiction.comnaturist-fiction.com

780791 (+27501)

660667 (-92623)

753291 Icon of naturistguiden.dknaturistguiden.dk

780792 (+27501)

753292 Icon of naturoghelse.dknaturoghelse.dk

780793 (+27501)

625324 (-127968)

753293 Icon of naturstyrelsen.dknaturstyrelsen.dk

423339 (-329954)

607943 (-145350)

603171 (-150122)

753294 Icon of naturvidenskabsfestival.dknaturvidenskabsfestival.dk
753295 Icon of navia.fonavia.fo

732555 (-20740)

753296 Icon of navnav.dknavnav.dk
753297 Icon of nb1949.co.jpnb1949.co.jp
753298 Icon of nbrchive.netnbrchive.net
753299 Icon of nbworkshoes.comnbworkshoes.com
753300 Icon of ncg.dkncg.dk
753301 Icon of ncp2-previewredirect-prod.azurewebsites.netncp2-previewredirect-prod.azurewebsites.net
753302 Icon of ncps-care.euncps-care.eu
753303 Icon of ndosupply.dkndosupply.dk
753304 Icon of ndtsventures.comndtsventures.com
753305 Icon of neb-online.deneb-online.de

629256 (-124049)

753306 Icon of nebbiolo-winebar.comnebbiolo-winebar.com

455173 (-298133)

753307 Icon of nefco.intnefco.int
753308 Icon of neiacademy.orgneiacademy.org
753309 Icon of nej-til-kattegatbro-ja-til-hyperloop.dknej-til-kattegatbro-ja-til-hyperloop.dk
753310 Icon of nelig.comnelig.com
753311 Icon of nem-bilsalg.dknem-bilsalg.dk
753312 Icon of nemadmin.dknemadmin.dk

780809 (+27497)

753313 Icon of nemsim.dknemsim.dk
753314 Icon of neoattack.comneoattack.com

482933 (-270381)

51092 (-702222)

135614 (-617700)

753315 Icon of neolane.netneolane.net

352507 (-400808)

753316 Icon of nepasurveys.comnepasurveys.com

660697 (-92619)

113568 (-639748)

753317 Icon of nerdgirl.dknerdgirl.dk
753318 Icon of neshergallery.comneshergallery.com
753319 Icon of net2traelast.dknet2traelast.dk
753320 Icon of netavisengrindsted.dknetavisengrindsted.dk

775275 (+21955)

660703 (-92617)

732578 (-20742)

753321 Icon of netdyredoktor.dknetdyredoktor.dk

646214 (-107107)

753322 Icon of netfordig.dknetfordig.dk

780822 (+27500)

732581 (-20741)

753323 Icon of netlingeri.dknetlingeri.dk

660709 (-92614)

753324 Icon of netogram.comnetogram.com
753325 Icon of nettips.dknettips.dk

722121 (-31204)

607944 (-145381)

732585 (-20740)

753326 Icon of nettiterveysapteekki.finettiterveysapteekki.fi
753327 Icon of nettofon.dknettofon.dk
753328 Icon of nettoskruer.dknettoskruer.dk

597771 (-155557)

732587 (-20741)

753329 Icon of networkcalculator.canetworkcalculator.ca
753330 Icon of networkcomputing.comnetworkcomputing.com

184717 (-568613)

231907 (-521423)

687738 (-65592)

127110 (-626220)

753331 Icon of networkinghowtos.comnetworkinghowtos.com
753332 Icon of networknature.eunetworknature.eu
753333 Icon of networthpick.comnetworthpick.com
753334 Icon of neurosoft.bgneurosoft.bg
753335 Icon of nevertherightword.comnevertherightword.com
753336 Icon of new-3lunch.netnew-3lunch.net

89022 (-664314)

753337 Icon of newbondstreetpawnbrokers.comnewbondstreetpawnbrokers.com

656951 (-96386)

753338 Icon of newdealinvest.dknewdealinvest.dk
753339 Icon of newmexicoregisteredagent.comnewmexicoregisteredagent.com

198398 (-554941)

753340 Icon of newmusicworld.orgnewmusicworld.org
753341 Icon of newsec.dknewsec.dk

780846 (+27505)

654176 (-99165)

753342 Icon of newspeek.infonewspeek.info

722124 (-31218)

635178 (-118164)

692634 (-60708)

753343 Icon of newspotng.comnewspotng.com
753344 Icon of newszkl.comnewszkl.com
753345 Icon of newtoki148.comnewtoki148.com

109571 (-643774)

124024 (-629321)

139985 (-613360)

753346 Icon of newtonrealestate.com.aunewtonrealestate.com.au
753347 Icon of newverest.comnewverest.com
753348 Icon of nextcar.dknextcar.dk

780853 (+27505)

753349 Icon of nextgrail.dknextgrail.dk
753350 Icon of nextlevelracing.comnextlevelracing.com

486072 (-267278)

126655 (-626695)

606680 (-146670)

753351 Icon of nextstepchallenge.comnextstepchallenge.com
753352 Icon of nf-ellebakken.dknf-ellebakken.dk
753353 Icon of nfa.nonfa.no

780855 (+27502)

654179 (-99174)

753354 Icon of nfggames.comnfggames.com

702378 (-50976)

660732 (-92622)

753355 Icon of nguyenhung.netnguyenhung.net

156704 (-596651)

223322 (-530033)

475996 (-277359)

144149 (-609206)

753356 Icon of nh-cap.comnh-cap.com
753357 Icon of nhasachminhphong.comnhasachminhphong.com

421798 (-331559)

356617 (-396740)

753358 Icon of nicehairyvagina.comnicehairyvagina.com

377551 (-375807)

643668 (-109690)

753359 Icon of nicemilfpics.comnicemilfpics.com

240766 (-512593)

122555 (-630804)

753360 Icon of nicknotas.comnicknotas.com

691230 (-62130)

230645 (-522715)

753361 Icon of nicolasgallagher.comnicolasgallagher.com

600519 (-152842)

753362 Icon of nicolettenaturalbeauty.comnicolettenaturalbeauty.com
753363 Icon of nicosub.dknicosub.dk
753364 Icon of niebomowidzisiaj.wordpress.comniebomowidzisiaj.wordpress.com

780867 (+27503)

732608 (-20756)

753365 Icon of nielsens.dknielsens.dk

658755 (-94610)

538650 (-214715)

726132 (-27233)

753366 Icon of nifty.appnifty.app
753367 Icon of nightlifescience.wordpress.comnightlifescience.wordpress.com
753368 Icon of nighttime-imaging.eunighttime-imaging.eu

664969 (-88399)

753369 Icon of nihaoyao.dknihaoyao.dk
753370 Icon of nihilistisk-folkeparti.dknihilistisk-folkeparti.dk
753371 Icon of nijiero-view.comnijiero-view.com

198638 (-554733)

180049 (-573322)

185851 (-567520)

753372 Icon of nik-great.blogspot.comnik-great.blogspot.com
753373 Icon of nikas-art.tumblr.comnikas-art.tumblr.com
753374 Icon of nikke-sea.comnikke-sea.com
753375 Icon of niko-records.blogspot.comniko-records.blogspot.com

780874 (+27499)

660747 (-92628)

732613 (-20762)

753376 Icon of nikon.dknikon.dk

736560 (-16816)

539070 (-214306)

753377 Icon of niksnacksonline.comniksnacksonline.com
753378 Icon of nilawield.shopnilawield.shop
753379 Icon of nilfisk-my.sharepoint.comnilfisk-my.sharepoint.com

780875 (+27496)

660749 (-92630)

717436 (-35943)

753380 Icon of nimit.plnimit.pl

418799 (-334581)

753381 Icon of ninathomas.orgninathomas.org
753382 Icon of ninet-forum.deninet-forum.de
753383 Icon of nintendo.dknintendo.dk

736561 (-16822)

753384 Icon of nintendoswitch.plnintendoswitch.pl
753385 Icon of nippon.dknippon.dk

658787 (-94598)

588816 (-164569)

726134 (-27251)

753386 Icon of nitter.orgnitter.org
753387 Icon of nivios.dknivios.dk
753388 Icon of njfpr.comnjfpr.com
753389 Icon of njordbolig.dknjordbolig.dk

780884 (+27495)

607949 (-145440)

753390 Icon of nk-inwestycje.plnk-inwestycje.pl
753391 Icon of nmbs.benmbs.be
753392 Icon of nnit.comnnit.com

588817 (-164575)

753393 Icon of noahskaalum.wixsite.comnoahskaalum.wixsite.com
753394 Icon of noaignite.comnoaignite.com

772778 (+19384)

732632 (-20762)

753395 Icon of noerrelandskirken.dknoerrelandskirken.dk

775295 (+21900)

753396 Icon of nogridprojects.comnogridprojects.com
753397 Icon of nohrlund.dknohrlund.dk
753398 Icon of nomadfrontiers.canomadfrontiers.ca
753399 Icon of nomeco.dknomeco.dk

591747 (-161652)

753400 Icon of nomilk.dknomilk.dk
753401 Icon of nonasuch.tumblr.comnonasuch.tumblr.com
753402 Icon of nonbo-eland.dknonbo-eland.dk

551771 (-201631)

726140 (-27262)

753403 Icon of noragerfysioterapi.dknoragerfysioterapi.dk

775298 (+21895)

753404 Icon of noragishop.comnoragishop.com
753405 Icon of norby.ccnorby.cc
753406 Icon of nord-apps.comnord-apps.com

264459 (-488947)

753407 Icon of nord-stream.comnord-stream.com

203638 (-549769)

753408 Icon of nordania.dknordania.dk

726141 (-27267)

753409 Icon of nordblomst.dknordblomst.dk
753410 Icon of nordeco.dknordeco.dk
753411 Icon of nordfjeld.dknordfjeld.dk
753412 Icon of nordfynsvand.dknordfynsvand.dk
753413 Icon of nordicagolf.dknordicagolf.dk
753414 Icon of nordicals.dknordicals.dk

772782 (+19368)

539989 (-213425)

726144 (-27270)

753415 Icon of nordicbasketball.comnordicbasketball.com

625973 (-127442)

753416 Icon of nordiccircularhotspot.orgnordiccircularhotspot.org
753417 Icon of nordiccomputer.comnordiccomputer.com

764788 (+11371)

753418 Icon of nordicexhibition.dknordicexhibition.dk
753419 Icon of nordichorse.dknordichorse.dk
753420 Icon of nordicnesting.dknordicnesting.dk

660790 (-92630)

753421 Icon of nordicnetcare.comnordicnetcare.com

775301 (+21880)

753422 Icon of nordicoil.dknordicoil.dk

772783 (+19361)

753423 Icon of nordicpayments.sharepoint.comnordicpayments.sharepoint.com
753424 Icon of nordicwoods.dknordicwoods.dk

660794 (-92630)

753425 Icon of nordiskfilmtv.dknordiskfilmtv.dk

732653 (-20772)

753426 Icon of nordjyllandstrafikselskab.dknordjyllandstrafikselskab.dk

699828 (-53598)

588819 (-164607)

753427 Icon of nordjyskejob.dknordjyskejob.dk

713047 (-40380)

660800 (-92627)

753428 Icon of nordjyskemuseer.dknordjyskemuseer.dk

780917 (+27489)

551772 (-201656)

674964 (-78464)

753429 Icon of nordjysktrofaemontering.dknordjysktrofaemontering.dk
753430 Icon of nordkraft.nonordkraft.no
753431 Icon of nordkystensdyrehospital.dknordkystensdyrehospital.dk
753432 Icon of nordlysmarketing.dknordlysmarketing.dk
753433 Icon of nordost.comnordost.com

736564 (-16869)

455835 (-297598)

753434 Icon of nords.dknords.dk
753435 Icon of normann-engineering.comnormann-engineering.com

673426 (-80009)

753436 Icon of norreg.dknorreg.dk
753437 Icon of norsmor.dknorsmor.dk
753438 Icon of northabroad.comnorthabroad.com
753439 Icon of northseastudio.dknorthseastudio.dk
753440 Icon of northsouthconnection.podbean.comnorthsouthconnection.podbean.com
753441 Icon of nosuchagency.dknosuchagency.dk
753442 Icon of nouinoui.comnouinoui.com
753443 Icon of novaindex.comnovaindex.com

732670 (-20773)

753444 Icon of novanordic.dknovanordic.dk

660820 (-92624)

753445 Icon of novelowl.comnovelowl.com
753446 Icon of novicell.comnovicell.com

780936 (+27490)

726154 (-27292)

753447 Icon of novihorizonti.banovihorizonti.ba
753448 Icon of novinki-serialov.netnovinki-serialov.net

340764 (-412684)

753449 Icon of novomoskovsknews.runovomoskovsknews.ru

133711 (-619738)

313586 (-439863)

753450 Icon of novusearthcontrol.comnovusearthcontrol.com
753451 Icon of nowushealthcare.comnowushealthcare.com

660827 (-92624)

753452 Icon of noyabrsknews.runoyabrsknews.ru

699032 (-54420)

124048 (-629404)

753453 Icon of nrcgroup.comnrcgroup.com

725457 (-27996)

753454 Icon of nrsb-boligselskab.dknrsb-boligselskab.dk

780947 (+27493)

660832 (-92622)

753455 Icon of nrsbbolig.dknrsbbolig.dk

775313 (+21858)

753456 Icon of nterworldkft.hunterworldkft.hu
753457 Icon of ntgear.dkntgear.dk
753458 Icon of ntreeshop.chntreeshop.ch

699360 (-54098)

753459 Icon of nuas.dknuas.dk
753460 Icon of nudeasianpics.netnudeasianpics.net

573838 (-179622)

155997 (-597463)

612842 (-140618)

753461 Icon of nudient.dknudient.dk

722135 (-31326)

753462 Icon of nuitsdelalecture.frnuitsdelalecture.fr
753463 Icon of numastays.comnumastays.com

301083 (-452380)

315733 (-437730)

753464 Icon of numbr.devnumbr.dev
753465 Icon of nummerplade.dknummerplade.dk
753466 Icon of nusens.netnusens.net

660843 (-92623)

732692 (-20774)

753467 Icon of nuuday.dknuuday.dk

775319 (+21852)

660846 (-92621)

684629 (-68838)

753468 Icon of nvcofny.comnvcofny.com
753469 Icon of nvhrbiblio.nlnvhrbiblio.nl

66481 (-686988)

753470 Icon of nwedible.comnwedible.com
753471 Icon of nwlaborpress.orgnwlaborpress.org
753472 Icon of nyborg-my.sharepoint.comnyborg-my.sharepoint.com
753473 Icon of nyborgs-room.comnyborgs-room.com

660851 (-92622)

753474 Icon of nykreditinvest.dknykreditinvest.dk

717445 (-36029)

753475 Icon of nypolitivennen.blogspot.comnypolitivennen.blogspot.com
753476 Icon of nytskab.dknytskab.dk
753477 Icon of nywintercon.comnywintercon.com
753478 Icon of nzblnk.infonzblnk.info

780970 (+27492)

660855 (-92623)

732704 (-20774)

753479 Icon of nzcouries.co.nznzcouries.co.nz
753480 Icon of nzozbolszewo.plnzozbolszewo.pl

780972 (+27492)

753481 Icon of o-service.dko-service.dk

780973 (+27492)

753482 Icon of oak-iwamizawa.comoak-iwamizawa.com
753483 Icon of oaqr.iooaqr.io
753484 Icon of oasehojskolen.dkoasehojskolen.dk

660860 (-92624)

753485 Icon of obd2tool.comobd2tool.com

619897 (-133588)

753486 Icon of obdadvisor.comobdadvisor.com

733892 (-19594)

753487 Icon of obiohaoti.comobiohaoti.com
753488 Icon of oblingmedia.comoblingmedia.com

660863 (-92625)

753489 Icon of oc.huoc.hu

171905 (-581584)

753490 Icon of occuity.comoccuity.com
753491 Icon of oceanhillsseniorliving.comoceanhillsseniorliving.com
753492 Icon of ocr.dkocr.dk
753493 Icon of odditymall.coodditymall.co
753494 Icon of oddsforum.dkoddsforum.dk

780983 (+27489)

753495 Icon of odense-idraetspark.dkodense-idraetspark.dk

780984 (+27489)

753496 Icon of odensebib.dkodensebib.dk

623585 (-129911)

753497 Icon of odensehavkajakklub.dkodensehavkajakklub.dk
753498 Icon of odensemetal.dkodensemetal.dk
753499 Icon of odenserundt.dkodenserundt.dk
753500 Icon of odinsgaard.dkodinsgaard.dk

775331 (+21831)