Alexa Top 645501 – 646000 Most Visited Websites – Most Popular Sites List 2022

Based on data from the Alexa rank, this page reveals the Alexa Top 645501 – 646000 most visited websites. We will be updating this list daily, so you can keep track of all the market shifts and spot changes in user interest.

kzworld.info is the top 645501 – 646000 most visited website in the world in 06/12/2022, who’s rank stayed the same, while the second-placed laanekassen.dk went up in the same period. lab3d.dk also performed well.

Depending on the methodology used, the results can have significant variability. However, having a reasonably accurate list is beneficial to the many use cases these lists can be applied to.

Alexa Top 645501 – 646000 Domain List

Alexa Top 645501 – 646000 Websites Ranking data updated according to the most recent updated in 06/12/2022.

Rank Domain Yesterday Last week Last month Last year
645501 Icon of kzworld.infokzworld.info

583553 (-61948)

652599 (+7098)

293433 (-352068)

645502 Icon of laanekassen.dklaanekassen.dk

587053 (-58449)

668868 (+23366)

645503 Icon of lab3d.dklab3d.dk
645504 Icon of laban.dklaban.dk
645505 Icon of laboca.eulaboca.eu
645506 Icon of labtech.dklabtech.dk

587054 (-58452)

681277 (+35771)

645211 (-295)

645507 Icon of labyrinthia.dklabyrinthia.dk
645508 Icon of ladefoged.wpenginepowered.comladefoged.wpenginepowered.com
645509 Icon of ladolce-vita.dkladolce-vita.dk
645510 Icon of laege-osteopat.dklaege-osteopat.dk
645511 Icon of laegehanne.dklaegehanne.dk
645512 Icon of laeremiddel.dklaeremiddel.dk

631361 (-14151)

645513 Icon of lagersalg.comlagersalg.com

529123 (-116390)

645514 Icon of lagkagehuset.dklagkagehuset.dk
645515 Icon of lago-di-garda.orglago-di-garda.org
645516 Icon of lairedu.frlairedu.fr
645517 Icon of lajk.rslajk.rs
645518 Icon of lakesidenewschapala.comlakesidenewschapala.com

592386 (-53132)

681290 (+35772)

645519 Icon of lampan.dklampan.dk

576574 (-68945)

645520 Icon of landbogruppen.dklandbogruppen.dk

681298 (+35778)

457331 (-188189)

645521 Icon of landekode.dklandekode.dk
645522 Icon of landfolk.comlandfolk.com
645523 Icon of landlaeknir.islandlaeknir.is
645524 Icon of landpremiumhotel.comlandpremiumhotel.com
645525 Icon of landskronahem.selandskronahem.se

592394 (-53131)

668899 (+23374)

645526 Icon of langagernet.wordpress.comlangagernet.wordpress.com
645527 Icon of langeland.dklangeland.dk
645528 Icon of lanterne.ailanterne.ai

676115 (+30587)

645529 Icon of lanzaroteexperiencetours.comlanzaroteexperiencetours.com
645530 Icon of lanzaroteguide.comlanzaroteguide.com
645531 Icon of lapalma-plaza.comlapalma-plaza.com
645532 Icon of laptopinventory.comlaptopinventory.com

339905 (-305627)

604636 (-40896)

629637 (-15895)

366995 (-278537)

645533 Icon of larbach.dklarbach.dk
645534 Icon of large-type.comlarge-type.com

207310 (-438224)

645535 Icon of larix.dklarix.dk
645536 Icon of lartdelautomobile.comlartdelautomobile.com
645537 Icon of lasnerdigital.comlasnerdigital.com
645538 Icon of lassemadsen.dklassemadsen.dk
645539 Icon of lassemc.dklassemc.dk

592400 (-53139)

645540 Icon of laudrup.dklaudrup.dk
645541 Icon of launchberg.comlaunchberg.com

371500 (-274041)

154093 (-491448)

645542 Icon of lauradalgaard.comlauradalgaard.com
645543 Icon of lavozdelaribera.mxlavozdelaribera.mx

592408 (-53135)

676118 (+30575)

645544 Icon of lavpris-laase.dklavpris-laase.dk

577609 (-67935)

645545 Icon of lavselvguiden.dklavselvguiden.dk
645546 Icon of lavthaimad.dklavthaimad.dk
645547 Icon of lavvvs.dklavvvs.dk
645548 Icon of lawncarewebdesign.comlawncarewebdesign.com
645549 Icon of lazy.comlazy.com
645550 Icon of lbs.dklbs.dk

631365 (-14185)

645551 Icon of lcbiler.dklcbiler.dk
645552 Icon of le-chef.dkle-chef.dk
645553 Icon of leadhub.dkleadhub.dk

592410 (-53143)

649201 (+3648)

645554 Icon of learn-danish.comlearn-danish.com
645555 Icon of learnbnb.comlearnbnb.com

495824 (-149731)

391544 (-254011)

645556 Icon of learncroatian.eulearncroatian.eu
645557 Icon of learnnatively.comlearnnatively.com

335912 (-309645)

106226 (-539331)

645558 Icon of learnpythontherightway.comlearnpythontherightway.com
645559 Icon of leatherdyke.pornleatherdyke.porn

474909 (-170650)

681338 (+35779)

363811 (-281748)

645560 Icon of lederne.dklederne.dk

613189 (-32371)

645561 Icon of ledpaerer.dkledpaerer.dk

661443 (+15882)

645562 Icon of legebyen.dklegebyen.dk

567923 (-77639)

681349 (+35787)

645563 Icon of legeland.dklegeland.dk

461078 (-184485)

636717 (-8846)

645564 Icon of legendaryheroesunchained.comlegendaryheroesunchained.com

402869 (-242695)

645565 Icon of legiontd2.comlegiontd2.com

486118 (-159447)

649202 (+3637)

645566 Icon of legitgrails.comlegitgrails.com

559685 (-85881)

529313 (-116253)

645567 Icon of legogroup-my.sharepoint.comlegogroup-my.sharepoint.com

383980 (-261587)

645568 Icon of lekmer.dklekmer.dk

592431 (-53137)

681359 (+35791)

645569 Icon of leminimacaron.dkleminimacaron.dk
645570 Icon of lemu.dklemu.dk

526265 (-119305)

563312 (-82258)

394729 (-250841)

645571 Icon of lendfoundry.comlendfoundry.com
645572 Icon of leo-pharma.comleo-pharma.com

676125 (+30553)

645573 Icon of lesalon.comlesalon.com
645574 Icon of lesclos.nllesclos.nl
645575 Icon of lesdeux.dklesdeux.dk

496453 (-149122)

664240 (+18665)

645576 Icon of lesgrappes.comlesgrappes.com

244305 (-401271)

160597 (-484979)

645577 Icon of letourcph.dkletourcph.dk
645578 Icon of letpension.dkletpension.dk
645579 Icon of lf.dklf.dk

592445 (-53134)

668948 (+23369)

645580 Icon of lfph.dklfph.dk

661447 (+15867)

645581 Icon of lfs.dklfs.dk
645582 Icon of lfstift.dklfstift.dk

681376 (+35794)

645583 Icon of lible.dklible.dk
645584 Icon of lidx.xyzlidx.xyz
645585 Icon of liebhaverboliger-danmark.dkliebhaverboliger-danmark.dk
645586 Icon of lif.dklif.dk
645587 Icon of lifafadenmark.comlifafadenmark.com
645588 Icon of lifeclub.dklifeclub.dk
645589 Icon of lifehackerguy.comlifehackerguy.com

433265 (-212324)

342350 (-303239)

645590 Icon of lifeinnica.comlifeinnica.com
645591 Icon of lifeoutandabout.com.aulifeoutandabout.com.au
645592 Icon of lighthousehockey.comlighthousehockey.com

399113 (-246479)

681388 (+35796)

645593 Icon of lightingconnection.comlightingconnection.com
645594 Icon of likehome.dklikehome.dk

668964 (+23370)

645595 Icon of lillyscorner.dklillyscorner.dk
645596 Icon of lily-silver-cgg4.squarespace.comlily-silver-cgg4.squarespace.com

587076 (-58520)

645597 Icon of limecity.dklimecity.dk
645598 Icon of limfjordsteatret.dklimfjordsteatret.dk
645599 Icon of limmudfsu.eulimmudfsu.eu
645600 Icon of lindenamsterdam.nllindenamsterdam.nl

492757 (-152843)

604746 (-40854)

645601 Icon of lindex.dklindex.dk
645602 Icon of linds.dklinds.dk

545055 (-100547)

631368 (-14234)

664254 (+18652)

645603 Icon of lineabolig.dklineabolig.dk
645604 Icon of linekohsel.dklinekohsel.dk
645605 Icon of linkcentralen.dklinkcentralen.dk

592466 (-53139)

681403 (+35798)

645606 Icon of liquidleds.com.auliquidleds.com.au

595666 (-49940)

465822 (-179784)

645607 Icon of liquorization.com.myliquorization.com.my

592469 (-53138)

681411 (+35804)

645608 Icon of lisalouisecooke.comlisalouisecooke.com

389681 (-255927)

645609 Icon of lisashea.comlisashea.com

615233 (-30376)

645610 Icon of liseborg.dkliseborg.dk
645611 Icon of lisg.dklisg.dk
645612 Icon of lissorensen.dklissorensen.dk
645613 Icon of listsofnote.comlistsofnote.com
645614 Icon of litehousefoods.comlitehousefoods.com
645615 Icon of litteraturlisteautomaten.dklitteraturlisteautomaten.dk

676138 (+30523)

668986 (+23371)

645616 Icon of littlehappy.dklittlehappy.dk

681416 (+35800)

645617 Icon of littlehappyfamily.dklittlehappyfamily.dk

668990 (+23373)

645618 Icon of littlekoo.comlittlekoo.com
645619 Icon of littleloveeveryday.comlittleloveeveryday.com
645620 Icon of live-fodbold.dklive-fodbold.dk
645621 Icon of living-guide.dkliving-guide.dk
645622 Icon of living-in-denmark.dkliving-in-denmark.dk
645623 Icon of living4all-dk.myshopify.comliving4all-dk.myshopify.com

592488 (-53135)

645624 Icon of livingbykolster.dklivingbykolster.dk

669000 (+23376)

645625 Icon of livingin-canada.comlivingin-canada.com

468685 (-176940)

249731 (-395894)

296095 (-349530)

645626 Icon of lizzardonline.comlizzardonline.com
645627 Icon of lkwfahr.delkwfahr.de
645628 Icon of lloh.dklloh.dk
645629 Icon of llyjmp.comllyjmp.com

343064 (-302565)

190207 (-455422)

79604 (-566025)

645630 Icon of lmlpro.comlmlpro.com
645631 Icon of loandenmark.dkloandenmark.dk

592493 (-53138)

663166 (+17535)

645632 Icon of lobergbolig.dklobergbolig.dk

592494 (-53138)

645633 Icon of lockit.co.illockit.co.il
645634 Icon of lodgable.comlodgable.com

239367 (-406267)

645635 Icon of lofkurser.dklofkurser.dk

587088 (-58547)

645636 Icon of lokk.dklokk.dk
645637 Icon of longbeachlanzarote.comlongbeachlanzarote.com
645638 Icon of longwangbt.comlongwangbt.com
645639 Icon of lookfantastic.dklookfantastic.dk

496114 (-149525)

256337 (-389302)

397996 (-247643)

645640 Icon of lookfoxy.dklookfoxy.dk
645641 Icon of lookseedo.dklookseedo.dk
645642 Icon of looksize.comlooksize.com

592510 (-53132)

363937 (-281705)

645643 Icon of loots.dkloots.dk
645644 Icon of looxis-pro.comlooxis-pro.com

576589 (-69055)

645645 Icon of lora.readthedocs.iolora.readthedocs.io

37091 (-608554)

645646 Icon of losmuertevideanos.wordpress.comlosmuertevideanos.wordpress.com
645647 Icon of lottotaldanske.dklottotaldanske.dk
645648 Icon of louislindberg.dklouislindberg.dk

681468 (+35820)

645649 Icon of love-partners.lifelove-partners.life

570915 (-74734)

201895 (-443754)

645650 Icon of loveanal.orgloveanal.org

595740 (-49910)

304880 (-340770)

645651 Icon of loveandpaint.comloveandpaint.com
645652 Icon of lovecam.dklovecam.dk
645653 Icon of lovecoupons.dklovecoupons.dk

681470 (+35817)

645654 Icon of loveoggs.comloveoggs.com

627939 (-17715)

645655 Icon of lovita.bloglovita.blog

592520 (-53135)

645656 Icon of lowcosttravel.clublowcosttravel.club
645657 Icon of lri.frlri.fr

495122 (-150535)

559805 (-85852)

397998 (-247659)

300034 (-345623)

645658 Icon of ls-vision.dkls-vision.dk

681472 (+35814)

669048 (+23390)

645659 Icon of ludios.orgludios.org
645660 Icon of luftens-helte.dkluftens-helte.dk
645661 Icon of lukeptaylor.comlukeptaylor.com
645662 Icon of luloweb-officiel.comluloweb-officiel.com
645663 Icon of lumant.dklumant.dk
645664 Icon of lundhede.comlundhede.com
645665 Icon of lunelamper.dklunelamper.dk
645666 Icon of lunge.dklunge.dk

587101 (-58565)

681489 (+35823)

669057 (+23391)

645667 Icon of lungemedicin.dklungemedicin.dk
645668 Icon of lusilashes.dklusilashes.dk
645669 Icon of luvbrite.comluvbrite.com

50806 (-594863)

645670 Icon of lux-case.dklux-case.dk

681493 (+35823)

645671 Icon of luxfit.comluxfit.com
645672 Icon of luxkids.dkluxkids.dk
645673 Icon of luxoliving.dkluxoliving.dk

576593 (-69080)

668671 (+22998)

669061 (+23388)

645674 Icon of luxresorts-nft.comluxresorts-nft.com
645675 Icon of luxuretv.lifeluxuretv.life

309377 (-336298)

243183 (-402492)

584381 (-61294)

645676 Icon of luxway.euluxway.eu
645677 Icon of luyenthitiengnhat.edu.vnluyenthitiengnhat.edu.vn

271327 (-374350)

645678 Icon of lykkemarianna.dklykkemarianna.dk

592538 (-53140)

676151 (+30473)

645679 Icon of lyngby.comlyngby.com
645680 Icon of lyngbystorcenter.dklyngbystorcenter.dk

681500 (+35820)

645681 Icon of lynxcollective.ltdlynxcollective.ltd

592542 (-53139)

645682 Icon of lysterapi.dklysterapi.dk

681505 (+35823)

664283 (+18601)

645683 Icon of lystfiskeriforeningen.dklystfiskeriforeningen.dk
645684 Icon of m1080.comm1080.com

434422 (-211262)

645685 Icon of maarsletlaegehus.dkmaarsletlaegehus.dk
645686 Icon of macacke.commacacke.com
645687 Icon of macnab.eumacnab.eu
645688 Icon of macpaw-com.translate.googmacpaw-com.translate.goog
645689 Icon of macrosoft.skmacrosoft.sk
645690 Icon of madforlivet.commadforlivet.com

617190 (-28500)

645691 Icon of madhorse668.commadhorse668.com

592552 (-53139)

681513 (+35822)

645692 Icon of madindustrien.dkmadindustrien.dk
645693 Icon of madklubbenderhjemme.dkmadklubbenderhjemme.dk

681514 (+35821)

645694 Icon of madmonkey.dkmadmonkey.dk
645695 Icon of madogkaerlighed.dkmadogkaerlighed.dk

526267 (-119428)

645696 Icon of madonkel.dkmadonkel.dk
645697 Icon of madrejsen.dkmadrejsen.dk

592556 (-53141)

681518 (+35821)

669094 (+23397)

645698 Icon of madsenmode.commadsenmode.com
645699 Icon of madygio.eu.orgmadygio.eu.org

358800 (-286899)

645700 Icon of maeglerringen.dkmaeglerringen.dk

545062 (-100638)

631373 (-14327)

645701 Icon of magasinetliv.dkmagasinetliv.dk

587107 (-58594)

621244 (-24457)

645702 Icon of magnificrock.commagnificrock.com
645703 Icon of magnustools.toolforge.orgmagnustools.toolforge.org
645704 Icon of magtor.dkmagtor.dk
645705 Icon of mahf.dkmahf.dk
645706 Icon of maileg.dkmaileg.dk

592569 (-53137)

645707 Icon of mailfit.commailfit.com
645708 Icon of mailvio.commailvio.com

540915 (-104793)

645709 Icon of mainstreamnetwork.commainstreamnetwork.com

442806 (-202903)

669111 (+23402)

645710 Icon of maintransport.rumaintransport.ru

592571 (-53139)

205770 (-439940)

304952 (-340758)

645711 Icon of maisonspa.romaisonspa.ro
645712 Icon of make-self.netmake-self.net

352635 (-293077)

645713 Icon of makelifeclick.commakelifeclick.com

171302 (-474411)

318704 (-327009)

645714 Icon of makemeapoem.commakemeapoem.com

681532 (+35818)

645715 Icon of makersupplies.dkmakersupplies.dk

635980 (-9735)

645716 Icon of makeup.dkmakeup.dk
645717 Icon of makita.dkmakita.dk

441261 (-204456)

644891 (-826)

645718 Icon of maklarhusetronneby.semaklarhusetronneby.se
645719 Icon of malgretout.dkmalgretout.dk
645720 Icon of malibunicaragua.commalibunicaragua.com
645721 Icon of mallcomm.co.ukmallcomm.co.uk
645722 Icon of maltegaard.commaltegaard.com
645723 Icon of mammothworkwear.commammothworkwear.com

676166 (+30443)

645724 Icon of mandemagasinet.dkmandemagasinet.dk
645725 Icon of mangia.dkmangia.dk
645726 Icon of manhuahun.commanhuahun.com
645727 Icon of maniajuns.commaniajuns.com
645728 Icon of maniex.dkmaniex.dk
645729 Icon of manimvmt.commanimvmt.com
645730 Icon of manneskraft-gesteigert.commanneskraft-gesteigert.com

571010 (-74720)

645731 Icon of manuall.dkmanuall.dk

545064 (-100667)

645732 Icon of maplecph.commaplecph.com
645733 Icon of mappedometer.commappedometer.com

434904 (-210829)

536622 (-109111)

645734 Icon of mara45123sims.blogspot.commara45123sims.blogspot.com
645735 Icon of marasaiz.commarasaiz.com
645736 Icon of marckozhd.dkmarckozhd.dk
645737 Icon of marcus.dkmarcus.dk

21728 (-624009)

645738 Icon of marcyyorsa.crd.comarcyyorsa.crd.co
645739 Icon of margaritavilleatlanta.commargaritavilleatlanta.com
645740 Icon of mariamelkatmour.memariamelkatmour.me
645741 Icon of mariavestergaard.dkmariavestergaard.dk

526269 (-119472)

681560 (+35819)

669145 (+23404)

645742 Icon of mariboseed.commariboseed.com
645743 Icon of mariebelle.hkmariebelle.hk
645744 Icon of marinetech.demarinetech.de
645745 Icon of marineways.commarineways.com
645746 Icon of marineworld.dkmarineworld.dk

669148 (+23402)

645747 Icon of marionevado.artmarionevado.art
645748 Icon of maritimedanmark.dkmaritimedanmark.dk

592599 (-53149)

645077 (-671)

645749 Icon of maritimtcenterhelsingoer.dkmaritimtcenterhelsingoer.dk
645750 Icon of markedsforing.dkmarkedsforing.dk

631379 (-14371)

628320 (-17430)

645751 Icon of marketingeon.commarketingeon.com
645752 Icon of marketprime.livemarketprime.live

646901 (+1149)

645753 Icon of markgoblog.xyzmarkgoblog.xyz
645754 Icon of markovate.commarkovate.com

435051 (-210703)

645755 Icon of markwaldorf.dkmarkwaldorf.dk

592601 (-53154)

645756 Icon of marmonretailsolutions.commarmonretailsolutions.com
645757 Icon of marmorosch.commarmorosch.com
645758 Icon of marosavat.commarosavat.com

453342 (-192416)

197404 (-448354)

645759 Icon of marquspizza.dkmarquspizza.dk

681573 (+35814)

645760 Icon of marramaque.jor.brmarramaque.jor.br
645761 Icon of marriageuncounseling.commarriageuncounseling.com

681574 (+35813)

645762 Icon of marriageuncounselingbonuses.commarriageuncounselingbonuses.com

592603 (-53159)

645763 Icon of marseilletourisme.frmarseilletourisme.fr

663243 (+17480)

645764 Icon of marshu.commarshu.com

435103 (-210661)

311758 (-334006)

645765 Icon of marstalsejlklub.dkmarstalsejlklub.dk
645766 Icon of martec.dkmartec.dk

592607 (-53159)

681575 (+35809)

664300 (+18534)

645767 Icon of martinschwartz.commartinschwartz.com
645768 Icon of martinsen.dkmartinsen.dk
645769 Icon of martinspa.nomartinspa.no
645770 Icon of martinus.dkmartinus.dk

587118 (-58652)

576092 (-69678)

645771 Icon of martinys.dkmartinys.dk

488848 (-156923)

631380 (-14391)

669156 (+23385)

645772 Icon of maseliving.dkmaseliving.dk
645773 Icon of mashaghelefars.commashaghelefars.com

171628 (-474145)

171336 (-474437)

332267 (-313506)

645774 Icon of masoncreekdental.commasoncreekdental.com
645775 Icon of massmind.orgmassmind.org

587120 (-58655)

645776 Icon of mastercubestore.dkmastercubestore.dk

610971 (-34805)

645777 Icon of masterz-app.commasterz-app.com

336213 (-309564)

645778 Icon of matecdev.commatecdev.com

592620 (-53158)

645779 Icon of matematikbanken.dkmatematikbanken.dk

580522 (-65257)

645780 Icon of matematikhfsvar.page.tlmatematikhfsvar.page.tl
645781 Icon of matematikskolen.dkmatematikskolen.dk

681593 (+35812)

645782 Icon of matermea.commatermea.com
645783 Icon of matlet.dkmatlet.dk

592624 (-53159)

645784 Icon of mattihaapoja.commattihaapoja.com

500459 (-145325)

183892 (-461892)

645785 Icon of mattressive.commattressive.com
645786 Icon of maturehotxxx.commaturehotxxx.com
645787 Icon of matureladiesass.commatureladiesass.com
645788 Icon of maturepornworld.commaturepornworld.com
645789 Icon of maturepornxxxsexvideo.commaturepornxxxsexvideo.com

547240 (-98549)

291461 (-354328)

645790 Icon of maturesexmature.commaturesexmature.com
645791 Icon of maturesexmovies.xxxmaturesexmovies.xxx

85293 (-560498)

407619 (-238172)

645792 Icon of maturetubefree.commaturetubefree.com
645793 Icon of max.dkmax.dk

491629 (-154164)

645794 Icon of max52.vipmax52.vip
645795 Icon of maxim88sg3.commaxim88sg3.com
645796 Icon of maxmcparts.dkmaxmcparts.dk
645797 Icon of maxsbrugtbiler.dkmaxsbrugtbiler.dk
645798 Icon of mayafreya.dkmayafreya.dk

592633 (-53165)

649635 (+3837)

645799 Icon of mayalabs.iomayalabs.io

681603 (+35804)

645800 Icon of maykers.commaykers.com
645801 Icon of mazda.dkmazda.dk

535905 (-109896)

616164 (-29637)

645802 Icon of mazdaofnewrochelle.commazdaofnewrochelle.com
645803 Icon of mbcemag.commbcemag.com
645804 Icon of mbtogb.commbtogb.com

519479 (-126325)

645805 Icon of mcfist.livejournal.commcfist.livejournal.com

592638 (-53167)

681609 (+35804)

669187 (+23382)

645806 Icon of measuringstuff.commeasuringstuff.com

500490 (-145316)

297729 (-348077)

109171 (-536635)

645807 Icon of medarbeideren.dkmedarbeideren.dk

545067 (-100740)

601251 (-44556)

645808 Icon of medarbejderne.dkmedarbejderne.dk
645809 Icon of medeasy.dkmedeasy.dk
645810 Icon of medela.dkmedela.dk

681615 (+35805)

645811 Icon of mediastandard.romediastandard.ro

175339 (-470472)

645812 Icon of medusblogs.lvmedusblogs.lv

551060 (-94752)

645813 Icon of medusveikals.lvmedusveikals.lv

592651 (-53162)

645814 Icon of medwatch.dkmedwatch.dk

592652 (-53162)

330890 (-314924)

645815 Icon of medynka.sitemedynka.site
645816 Icon of meetmecdna.commeetmecdna.com
645817 Icon of meetv.dkmeetv.dk

289615 (-356202)

681628 (+35811)

601252 (-44565)

645818 Icon of megaport.chmegaport.ch
645819 Icon of megatix.co.idmegatix.co.id

486434 (-159385)

595990 (-49829)

486941 (-158878)

645820 Icon of megavideo.commegavideo.com

115990 (-529830)

645821 Icon of megavst.commegavst.com
645822 Icon of megegyet.humegegyet.hu

592657 (-53165)

637822 (-8000)

645823 Icon of meilen-meister.commeilen-meister.com
645824 Icon of meilenpunkteundmehr.demeilenpunkteundmehr.de
645825 Icon of mejlbyefterskole.dkmejlbyefterskole.dk
645826 Icon of mekanikerenmiddelfart.dkmekanikerenmiddelfart.dk
645827 Icon of melone.dkmelone.dk
645828 Icon of melorra.commelorra.com

57862 (-587966)

645829 Icon of meltingspot.iomeltingspot.io

368732 (-277097)

645830 Icon of memira.dkmemira.dk

631384 (-14446)

394511 (-251319)

645831 Icon of memorie.almemorie.al
645832 Icon of menazeria.com.plmenazeria.com.pl
645833 Icon of menighedsraad.dkmenighedsraad.dk

681641 (+35808)

662759 (+16926)

645834 Icon of menyborupsalle.dkmenyborupsalle.dk
645835 Icon of mephitsu.co.ukmephitsu.co.uk
645836 Icon of meplusyou.clubmeplusyou.club
645837 Icon of mercedes-benz.romercedes-benz.ro

425329 (-220508)

645838 Icon of merchantservice1.commerchantservice1.com
645839 Icon of merics.orgmerics.org

20035 (-625804)

608706 (-37133)

645840 Icon of merlosepizzaria.dkmerlosepizzaria.dk
645841 Icon of message.dkmessage.dk

526640 (-119201)

609399 (-36442)

584592 (-61249)

645842 Icon of messyweekend.dkmessyweekend.dk

580528 (-65314)

591466 (-54376)

645843 Icon of metal-supply.dkmetal-supply.dk

668683 (+22840)

597631 (-48212)

645844 Icon of metalforcesmagazine.commetalforcesmagazine.com
645845 Icon of metlculousdates.netmetlculousdates.net
645846 Icon of metodistkirken-esbjerg.dkmetodistkirken-esbjerg.dk
645847 Icon of metodistkirken.dkmetodistkirken.dk

661900 (+16053)

645848 Icon of metro-optics.commetro-optics.com

593581 (-52267)

645849 Icon of mewore.moemewore.moe
645850 Icon of mgn.ggmgn.gg
645851 Icon of mgreen27.github.iomgreen27.github.io
645852 Icon of mhome.dkmhome.dk

592683 (-53169)

669237 (+23385)

645853 Icon of miappi.commiappi.com

626180 (-19673)

645854 Icon of michaelsaves.commichaelsaves.com

349618 (-296236)

499480 (-146374)

236749 (-409105)

645855 Icon of midsizesteph.co.ukmidsizesteph.co.uk
645856 Icon of midtjyskastro.dkmidtjyskastro.dk
645857 Icon of midtjyskboligselskab.dkmidtjyskboligselskab.dk
645858 Icon of midway42.orgmidway42.org
645859 Icon of miele.dkmiele.dk

628749 (-17110)

149710 (-496149)

645860 Icon of miila.dkmiila.dk

477083 (-168777)

645861 Icon of miinosoft.commiinosoft.com

384862 (-260999)

605077 (-40784)

359082 (-286779)

645862 Icon of mikakus.commikakus.com

599259 (-46603)

645863 Icon of mikebarnkob.dkmikebarnkob.dk
645864 Icon of mikesport.eumikesport.eu

390036 (-255828)

645865 Icon of mikonomi.dkmikonomi.dk

631387 (-14478)

645866 Icon of miles-and-more-kreditkarte.commiles-and-more-kreditkarte.com

530739 (-115127)

645867 Icon of miles4you.demiles4you.de
645868 Icon of milfsexmovies.commilfsexmovies.com
645869 Icon of milfstockingstgp.commilfstockingstgp.com

316295 (-329574)

645870 Icon of militaerfoto.dkmilitaerfoto.dk
645871 Icon of miljoetaepper.dkmiljoetaepper.dk

576604 (-69267)

645872 Icon of miljoezoner.dkmiljoezoner.dk

592700 (-53172)

645873 Icon of milk-studio.dkmilk-studio.dk

681682 (+35809)

645874 Icon of milkcratesdirect.commilkcratesdirect.com
645875 Icon of milleoglykke.dkmilleoglykke.dk
645876 Icon of milwaukeerecord.commilwaukeerecord.com

170916 (-474960)

499729 (-146147)

538457 (-107419)

154062 (-491814)

645877 Icon of minadvokat.dkminadvokat.dk
645878 Icon of mindedge.commindedge.com
645879 Icon of minecraftyard.comminecraftyard.com

288436 (-357443)

272710 (-373169)

645880 Icon of minejendom.dkminejendom.dk
645881 Icon of minelist.dkminelist.dk

592710 (-53171)

645882 Icon of minesweeper.infominesweeper.info
645883 Icon of minfot.dkminfot.dk

592715 (-53168)

681693 (+35810)

645884 Icon of minigolfclub.iominigolfclub.io
645885 Icon of minimaxir.comminimaxir.com

547316 (-98569)

645886 Icon of minmekaniker.dkminmekaniker.dk
645887 Icon of minstroem.appminstroem.app
645888 Icon of mira.camira.ca
645889 Icon of mircealungu.commircealungu.com
645890 Icon of mirkemenagerie.tumblr.commirkemenagerie.tumblr.com
645891 Icon of mis.co.ilmis.co.il

592721 (-53170)

681702 (+35811)

645892 Icon of missen.dkmissen.dk
645893 Icon of mistercomparador.commistercomparador.com
645894 Icon of mit-digitale-selvforsvar.herokuapp.commit-digitale-selvforsvar.herokuapp.com

592730 (-53164)

645895 Icon of mitflottesmil.dkmitflottesmil.dk

587156 (-58739)

645896 Icon of mithus.dkmithus.dk
645897 Icon of mitjagtblad.dkmitjagtblad.dk
645898 Icon of mitmartec.dkmitmartec.dk
645899 Icon of mitmelva.dkmitmelva.dk

587158 (-58741)

681711 (+35812)

669299 (+23400)

645900 Icon of mitronix.commitronix.com
645901 Icon of mitteldorf.dkmitteldorf.dk
645902 Icon of mitucl.dkmitucl.dk
645903 Icon of mitvand.dkmitvand.dk
645904 Icon of mixitcloud.commixitcloud.com

574794 (-71110)

420112 (-225792)

645905 Icon of mixmove.iomixmove.io
645906 Icon of mkhchu.blogspot.commkhchu.blogspot.com

203948 (-441958)

645907 Icon of mkservers.irmkservers.ir
645908 Icon of mkto-ab340124.commkto-ab340124.com
645909 Icon of mlaw.dkmlaw.dk
645910 Icon of mmaction.dkmmaction.dk

621253 (-24657)

649217 (+3307)

645911 Icon of mmeshapes.commmeshapes.com
645912 Icon of mmf.dkmmf.dk

676206 (+30294)

645084 (-828)

645913 Icon of mmoexp.commmoexp.com

672445 (+26532)

645914 Icon of mmtom.orgmmtom.org

554533 (-91381)

645915 Icon of mmuncii.rommuncii.ro

87488 (-558427)

645916 Icon of mmw2021.wixsite.commmw2021.wixsite.com
645917 Icon of mobilemusicpro.commobilemusicpro.com
645918 Icon of mobilforalle.dkmobilforalle.dk
645919 Icon of mobiltest.dkmobiltest.dk
645920 Icon of mobiltpasfoto.dkmobiltpasfoto.dk
645921 Icon of mobinfinity.xyzmobinfinity.xyz

592751 (-53170)

645922 Icon of mobiri.semobiri.se

316346 (-329576)

164536 (-481386)

645923 Icon of moccsplace.commoccsplace.com
645924 Icon of mochasoft.dkmochasoft.dk
645925 Icon of modeguru.dkmodeguru.dk

681735 (+35810)

645926 Icon of modekompagniet.dkmodekompagniet.dk

523766 (-122160)

645927 Icon of modeldesignconstruction.co.ukmodeldesignconstruction.co.uk
645928 Icon of modeledo.plmodeledo.pl

395613 (-250315)

645929 Icon of modelers-reference.commodelers-reference.com
645930 Icon of moderndogmagazine.commoderndogmagazine.com

342996 (-302934)

645931 Icon of modernehjem.dkmodernehjem.dk
645932 Icon of modernekirkekunst.dkmodernekirkekunst.dk
645933 Icon of modernemoebler.dkmodernemoebler.dk
645934 Icon of modstroem.dkmodstroem.dk

600621 (-45313)

664343 (+18409)

645935 Icon of modulor.demodulor.de

146845 (-499090)

681745 (+35810)

103495 (-542440)

645936 Icon of moebel-boss.demoebel-boss.de

232825 (-413111)

201442 (-444494)

645937 Icon of moedrehjaelpen.dkmoedrehjaelpen.dk

592761 (-53176)

681748 (+35811)

645938 Icon of moeselo.kr.uamoeselo.kr.ua
645939 Icon of moeyo.commoeyo.com

108121 (-537818)

49378 (-596561)

645940 Icon of mohawkgames.commohawkgames.com
645941 Icon of mohiguide.commohiguide.com
645942 Icon of mojo.dkmojo.dk

580541 (-65401)

621254 (-24688)

645943 Icon of mojodesk.commojodesk.com

378908 (-267035)

645944 Icon of mok.dkmok.dk
645945 Icon of molgroupcareers.infomolgroupcareers.info
645946 Icon of mollers.nomollers.no

647347 (+1401)

645947 Icon of mommer.wordpress.commommer.wordpress.com
645948 Icon of momocafe.netmomocafe.net

363099 (-282849)

645949 Icon of momowok.dkmomowok.dk
645950 Icon of momsboyssex.commomsboyssex.com

111205 (-534745)

209920 (-436030)

645951 Icon of monchoujewelry.commonchoujewelry.com
645952 Icon of mongolianfootball.commongolianfootball.com
645953 Icon of monopra.jpmonopra.jp
645954 Icon of monsolar.netmonsolar.net
645955 Icon of moonmenllc.commoonmenllc.com
645956 Icon of morefut.commorefut.com

336450 (-309506)

236112 (-409844)

61478 (-584478)

645957 Icon of mormorsloft.dkmormorsloft.dk
645958 Icon of morrisonhotelgallery.commorrisonhotelgallery.com

265930 (-380028)

645959 Icon of morskoekken.dkmorskoekken.dk
645960 Icon of morsskole.sharepoint.commorsskole.sharepoint.com

577767 (-68193)

645961 Icon of mortens-trafikskole.dkmortens-trafikskole.dk
645962 Icon of mosevenezia.eumosevenezia.eu

271832 (-374130)

500511 (-145451)

645963 Icon of mosmosh.commosmosh.com

587167 (-58796)

621500 (-24463)

577031 (-68932)

645964 Icon of mostersskur.dkmostersskur.dk

669352 (+23388)

645965 Icon of mostonline.humostonline.hu
645966 Icon of mothershipadrift.commothershipadrift.com
645967 Icon of motion-online.dkmotion-online.dk

631398 (-14569)

645968 Icon of motodiesel.plmotodiesel.pl

475334 (-170634)

328973 (-316995)

376038 (-269930)

645969 Icon of motoline-racing.commotoline-racing.com
645970 Icon of motomanuals.netmotomanuals.net

634118 (-11852)

645971 Icon of motoonline.commotoonline.com
645972 Icon of motorcycle-manual.commotorcycle-manual.com
645973 Icon of motorcykelgalleri.dkmotorcykelgalleri.dk

576609 (-69364)

539478 (-106495)

645974 Icon of motordoctor.dkmotordoctor.dk

592795 (-53179)

681776 (+35802)

645975 Icon of motorhistorisk.dkmotorhistorisk.dk

551063 (-94912)

645976 Icon of motorino.camotorino.ca

212626 (-433350)

645977 Icon of motorsiden.dkmotorsiden.dk

545078 (-100899)

681778 (+35801)

645978 Icon of motorsportshop.dkmotorsportshop.dk

592796 (-53182)

676224 (+30246)

664354 (+18376)

645979 Icon of motospeed.ccmotospeed.cc
645980 Icon of move.ggmove.gg
645981 Icon of movertransport.commovertransport.com

669365 (+23384)

645982 Icon of moviesjoy.sitemoviesjoy.site
645983 Icon of moviezoo.dkmoviezoo.dk

529126 (-116857)

681788 (+35805)

645984 Icon of moving-to-denmark.dkmoving-to-denmark.dk
645985 Icon of mozillapl.orgmozillapl.org

475348 (-170637)

645986 Icon of mp4moviez.lovemp4moviez.love

592805 (-53181)

681793 (+35807)

669370 (+23384)

106800 (-539186)

645987 Icon of mpr.orgmpr.org
645988 Icon of mr-furniture.commr-furniture.com
645989 Icon of mrbiz.eumrbiz.eu
645990 Icon of mrchowliquorstore.commrchowliquorstore.com

592808 (-53182)

668695 (+22705)

645991 Icon of mrrooter.commrrooter.com

271845 (-374146)

539700 (-106291)

645992 Icon of mrskimmonster.tumblr.commrskimmonster.tumblr.com
645993 Icon of msecure117.commsecure117.com
645994 Icon of mshkshh.tumblr.commshkshh.tumblr.com

592819 (-53175)

645995 Icon of mti.dkmti.dk
645996 Icon of mtv-ludwigsburg.demtv-ludwigsburg.de
645997 Icon of mudafy.com.armudafy.com.ar

539844 (-106153)

645998 Icon of muldvarpebekaempelse.dkmuldvarpebekaempelse.dk
645999 Icon of muller-property.co.ukmuller-property.co.uk
646000 Icon of multilingual-date.commultilingual-date.com

681813 (+35813)