Alexa Top 622001 – 622500 Most Visited Websites – Most Popular Sites List 2022

Based on data from the Alexa rank, this page reveals the Alexa Top 622001 – 622500 most visited websites. We will be updating this list daily, so you can keep track of all the market shifts and spot changes in user interest.

interlinegroup.com is the top 622001 – 622500 most visited website in the world in 27/11/2022, who’s rank stayed the same, while the second-placed intermix.io stayed the same in the same period. international-railway-safety-council.com also performed well.

Depending on the methodology used, the results can have significant variability. However, having a reasonably accurate list is beneficial to the many use cases these lists can be applied to.

Alexa Top 622001 – 622500 Domain List

Alexa Top 622001 – 622500 Websites Ranking data updated according to the most recent updated in 27/11/2022.

Rank Domain Yesterday Last week Last month Last year
622001 Icon of interlinegroup.cominterlinegroup.com
622002 Icon of intermix.iointermix.io
622003 Icon of international-railway-safety-council.cominternational-railway-safety-council.com
622004 Icon of internet.isinternet.is

659641 (+37637)

709032 (+87028)

744855 (+122851)

622005 Icon of interracialreality.cominterracialreality.com

516583 (-105422)

159980 (-462025)

536703 (-85302)

622006 Icon of intervare.dkintervare.dk

709036 (+87030)

622007 Icon of intim76.comintim76.com

171197 (-450810)

622008 Icon of inuit.dkinuit.dk
622009 Icon of investingintheweb.cominvestingintheweb.com

684582 (+62573)

622010 Icon of inviteforum.cominviteforum.com
622011 Icon of iogates.comiogates.com

709044 (+87033)

622012 Icon of ipnordic.dkipnordic.dk

703912 (+81900)

622013 Icon of iqoptions.dkiqoptions.dk

607885 (-14128)

709055 (+87042)

630461 (+8448)

622014 Icon of ir-d.dkir-d.dk

653882 (+31868)

622015 Icon of iranhumanrights.orgiranhumanrights.org

312516 (-309499)

618133 (-3882)

622016 Icon of irishfa.comirishfa.com
622017 Icon of irishmetalarchive.comirishmetalarchive.com
622018 Icon of ironflx.comironflx.com

653886 (+31868)

375470 (-246548)

740236 (+118218)

28769 (-593249)

622019 Icon of irsystem.plirsystem.pl

659670 (+37651)

622020 Icon of iset-pi.geiset-pi.ge
622021 Icon of isf.foisf.fo
622022 Icon of islebjergkirke.dkislebjergkirke.dk
622023 Icon of isnowhome.comisnowhome.com

659679 (+37656)

744877 (+122854)

622024 Icon of isofilm.dkisofilm.dk
622025 Icon of isok.gov.plisok.gov.pl
622026 Icon of isports.dkisports.dk
622027 Icon of ispw.meispw.me
622028 Icon of ista.comista.com

509767 (-112261)

731637 (+109609)

622029 Icon of istanbul-halalmarket.comistanbul-halalmarket.com
622030 Icon of it-borger.dkit-borger.dk

659683 (+37653)

709066 (+87036)

744881 (+122851)

622031 Icon of italy.dkitaly.dk
622032 Icon of itchmarketing.dkitchmarketing.dk

685274 (+63242)

622033 Icon of itelligence.dkitelligence.dk

709073 (+87040)

622034 Icon of itemforge.comitemforge.com

502280 (-119754)

614644 (-7390)

622035 Icon of itforumvest.dkitforumvest.dk
622036 Icon of ithansen.dkithansen.dk

659687 (+37651)

622037 Icon of itogco.dkitogco.dk
622038 Icon of itpays.noitpays.no

636809 (+14771)

622039 Icon of itporady.plitporady.pl
622040 Icon of itprofi.in.uaitprofi.in.ua
622041 Icon of itsakat-my.sharepoint.comitsakat-my.sharepoint.com
622042 Icon of ittroops-ua.comittroops-ua.com
622043 Icon of itucation.dkitucation.dk

709075 (+87032)

622044 Icon of itvang.dkitvang.dk

709076 (+87032)

622045 Icon of iu.dkiu.dk
622046 Icon of iv-an-ru.livejournal.comiv-an-ru.livejournal.com

642901 (+20855)

622047 Icon of ivo-welch.infoivo-welch.info

709078 (+87031)

622048 Icon of iwm-tuebingen.deiwm-tuebingen.de
622049 Icon of ixxx.dateixxx.date
622050 Icon of j.mpj.mp

393566 (-228484)

482020 (-140030)

622051 Icon of jacked.dkjacked.dk
622052 Icon of jackjonesholstebro.dkjackjonesholstebro.dk
622053 Icon of jacobsenbryg.dkjacobsenbryg.dk
622054 Icon of jacobsenplus.dkjacobsenplus.dk

585627 (-36427)

373886 (-248168)

622055 Icon of jade-net-home.xyzjade-net-home.xyz
622056 Icon of jaegerhuset.dkjaegerhuset.dk

709090 (+87034)

622057 Icon of jaegernesmagasin.dkjaegernesmagasin.dk
622058 Icon of jagttegnkurser.dkjagttegnkurser.dk
622059 Icon of jakartaveganguide.comjakartaveganguide.com

653898 (+31839)

622060 Icon of jakim-prawem.pljakim-prawem.pl
622061 Icon of jakon.dkjakon.dk

653899 (+31838)

695552 (+73491)

622062 Icon of jammerbugtfc.dkjammerbugtfc.dk
622063 Icon of jandbmedical.comjandbmedical.com
622064 Icon of japaneseknifecompany.comjapaneseknifecompany.com

313080 (-308984)

622065 Icon of japanoholic.dkjapanoholic.dk
622066 Icon of japanspecialisten.dkjapanspecialisten.dk
622067 Icon of jatakportalen.dkjatakportalen.dk
622068 Icon of jav.skinjav.skin

183873 (-438195)

622069 Icon of javsexjapan.comjavsexjapan.com
622070 Icon of javup.orgjavup.org

263577 (-358493)

349718 (-272352)

622071 Icon of jayceemoorephoto.comjayceemoorephoto.com
622072 Icon of jbyjfashion.dkjbyjfashion.dk
622073 Icon of jeelkas.sharepoint.comjeelkas.sharepoint.com

653903 (+31830)

697294 (+75221)

622074 Icon of jelibuiltperformance.comjelibuiltperformance.com
622075 Icon of jemalift.dkjemalift.dk
622076 Icon of jenner.dkjenner.dk
622077 Icon of jesper-hustad.github.iojesper-hustad.github.io

659729 (+37652)

370729 (-251348)

118999 (-503078)

622078 Icon of jespernissenseo.wordpress.comjespernissenseo.wordpress.com
622079 Icon of jesus2027.comjesus2027.com

545349 (-76730)

622080 Icon of jetpackcompose.netjetpackcompose.net

688409 (+66329)

244480 (-377600)

622081 Icon of jewelief.comjewelief.com

631699 (+9618)

622082 Icon of jf-parede.ptjf-parede.pt

609874 (-12208)

381373 (-240709)

482043 (-140039)

622083 Icon of jfmedier.dkjfmedier.dk

709126 (+87043)

606947 (-15136)

622084 Icon of jfnet.dejfnet.de

211496 (-410588)

703938 (+81854)

731647 (+109563)

622085 Icon of jgtech.comjgtech.com
622086 Icon of jhf.go.jpjhf.go.jp

95325 (-526761)

622087 Icon of jiiqii.comjiiqii.com

125519 (-496568)

622088 Icon of jinxit.carrd.cojinxit.carrd.co
622089 Icon of jinxitcomms.carrd.cojinxitcomms.carrd.co
622090 Icon of jisaku-pc.netjisaku-pc.net

178658 (-443432)

185001 (-437089)

622091 Icon of jj-montering.dkjj-montering.dk
622092 Icon of jkoffice.dkjkoffice.dk

740255 (+118163)

622093 Icon of jkplace.comjkplace.com
622094 Icon of jl-auto.dkjl-auto.dk
622095 Icon of jl-energy.dkjl-energy.dk

655588 (+33493)

622096 Icon of jl-fuger.dkjl-fuger.dk

653911 (+31815)

622097 Icon of jlrms.comjlrms.com

389444 (-232653)

298014 (-324083)

622098 Icon of jna.dkjna.dk

631700 (+9602)

685280 (+63182)

622099 Icon of joanarmatrading.comjoanarmatrading.com
622100 Icon of joanb.dkjoanb.dk
622101 Icon of joannahuset.dkjoannahuset.dk

740259 (+118158)

622102 Icon of jobbank.dkjobbank.dk

585358 (-36744)

709134 (+87032)

622103 Icon of jobcenter.dkjobcenter.dk
622104 Icon of jobdanmark.dkjobdanmark.dk
622105 Icon of johnimsecrets.comjohnimsecrets.com
622106 Icon of johnnovak.netjohnnovak.net
622107 Icon of jokesquotesfactory.comjokesquotesfactory.com

448584 (-173523)

433321 (-188786)

622108 Icon of jokokan.comjokokan.com

659762 (+37654)

622109 Icon of jonimitchell.comjonimitchell.com

545798 (-76311)

622110 Icon of jonsmadklub.dkjonsmadklub.dk

709145 (+87035)

622111 Icon of jordemoderforeningen.dkjordemoderforeningen.dk
622112 Icon of josafety.dkjosafety.dk

659766 (+37654)

695560 (+73448)

709046 (+86934)

622113 Icon of joseph-mccarthy.github.iojoseph-mccarthy.github.io
622114 Icon of joyful.dkjoyful.dk
622115 Icon of joyfulbikeshedding.comjoyfulbikeshedding.com
622116 Icon of joyinoneminute.comjoyinoneminute.com
622117 Icon of jpbookstore.comjpbookstore.com

480600 (-141517)

178735 (-443382)

622118 Icon of jppgnet.comjppgnet.com
622119 Icon of jppol.sharepoint.comjppol.sharepoint.com

645407 (+23288)

744979 (+122860)

622120 Icon of jpsex-xxx.comjpsex-xxx.com

126423 (-495697)

411327 (-210793)

545947 (-76173)

622121 Icon of jsta.github.iojsta.github.io
622122 Icon of jtleek.comjtleek.com
622123 Icon of juels.dkjuels.dk
622124 Icon of juf.dkjuf.dk

655591 (+33467)

740270 (+118146)

622125 Icon of jujutsu-kaisenmanga.comjujutsu-kaisenmanga.com

268973 (-353152)

556591 (-65534)

622126 Icon of julehjaelp-w2v3e.ondigitalocean.appjulehjaelp-w2v3e.ondigitalocean.app
622127 Icon of julekoncerter.dkjulekoncerter.dk

709158 (+87031)

622128 Icon of julekurv.nujulekurv.nu
622129 Icon of juletraditioner.dkjuletraditioner.dk
622130 Icon of julforalle.dkjulforalle.dk

659794 (+37664)

622131 Icon of jumbotransport.dkjumbotransport.dk
622132 Icon of jurabibliotek.dkjurabibliotek.dk

667425 (+45293)

744994 (+122862)

622133 Icon of juraeksperten.dkjuraeksperten.dk
622134 Icon of just4keepers.co.ukjust4keepers.co.uk
622135 Icon of justpersonalise.comjustpersonalise.com
622136 Icon of justsyn.comjustsyn.com
622137 Icon of juventus.gejuventus.ge

653924 (+31787)

709166 (+87029)

622138 Icon of jvaltane.kapsi.fijvaltane.kapsi.fi
622139 Icon of jvd-archery.comjvd-archery.com

659807 (+37668)

709167 (+87028)

745006 (+122867)

622140 Icon of jwojewelers.comjwojewelers.com
622141 Icon of jyskbil.dkjyskbil.dk
622142 Icon of jyske-opera.dkjyske-opera.dk
622143 Icon of jzavzy.comjzavzy.com

659818 (+37675)

622144 Icon of k1x.comk1x.com
622145 Icon of k4mb1maps.comk4mb1maps.com

633273 (+11128)

622146 Icon of ka-slagelse.dkka-slagelse.dk
622147 Icon of kabukiso.comkabukiso.com

185108 (-437039)

97224 (-524923)

622148 Icon of kad-ringen.dkkad-ringen.dk
622149 Icon of kaffeexpressen.dkkaffeexpressen.dk
622150 Icon of kagedeko.dkkagedeko.dk
622151 Icon of kaiser-fototechnik.dekaiser-fototechnik.de

248236 (-373915)

622152 Icon of kaivalyamretreat.comkaivalyamretreat.com
622153 Icon of kajakhotellet.dkkajakhotellet.dk

745016 (+122863)

622154 Icon of kalaskongen.dkkalaskongen.dk
622155 Icon of kalhotkomat.czkalhotkomat.cz
622156 Icon of kalkknuser.dkkalkknuser.dk
622157 Icon of kallbadhuset.sekallbadhuset.se
622158 Icon of kaloderma.comkaloderma.com

659832 (+37674)

622159 Icon of kalundborg-skov-park-have.dkkalundborg-skov-park-have.dk
622160 Icon of kamyagyno.inkamyagyno.in
622161 Icon of kapwatch.dkkapwatch.dk

659847 (+37686)

740285 (+118124)

622162 Icon of karakternet.dkkarakternet.dk

709203 (+87041)

622163 Icon of kareten.dkkareten.dk
622164 Icon of karitha.iokaritha.io

659852 (+37688)

622165 Icon of karkar.com.hkkarkar.com.hk
622166 Icon of karlinnas.dkkarlinnas.dk
622167 Icon of karlslundefodbold.dkkarlslundefodbold.dk

659855 (+37688)

740286 (+118119)

622168 Icon of karrieretanken.dkkarrieretanken.dk

659856 (+37688)

622169 Icon of kartoffelmuseum.dkkartoffelmuseum.dk
622170 Icon of karupaa.dkkarupaa.dk
622171 Icon of kasimir.myds.mekasimir.myds.me
622172 Icon of kaspersky.dkkaspersky.dk

703962 (+81790)

745039 (+122867)

622173 Icon of kastapp.cokastapp.co
622174 Icon of kataricsg.comkataricsg.com
622175 Icon of kate.dkkate.dk
622176 Icon of katnyt.dkkatnyt.dk

653941 (+31765)

622177 Icon of katrineberling.dkkatrineberling.dk
622178 Icon of kattegalleri.dkkattegalleri.dk
622179 Icon of kattegatforbindelse.dkkattegatforbindelse.dk
622180 Icon of kaushikroychowdhury.comkaushikroychowdhury.com
622181 Icon of kavery.org.inkavery.org.in
622182 Icon of kbbreview.comkbbreview.com

313178 (-309004)

622183 Icon of kbhcykler.dkkbhcykler.dk

635101 (+12918)

622184 Icon of kboges.comkboges.com

386607 (-235577)

622185 Icon of kcdbundle.comkcdbundle.com
622186 Icon of kebabhouse9000.dkkebabhouse9000.dk

703966 (+81780)

622187 Icon of keebcats.co.ukkeebcats.co.uk

449115 (-173072)

622188 Icon of keeled.eekeeled.ee
622189 Icon of keeper1st.comkeeper1st.com
622190 Icon of kellerlaw.dkkellerlaw.dk
622191 Icon of kellysxo.comkellysxo.com
622192 Icon of kemono.cafekemono.cafe

589633 (-32559)

683653 (+61461)

622193 Icon of kenkohealth.inkenkohealth.in

91181 (-531012)

178605 (-443588)

622194 Icon of kennedyeng.comkennedyeng.com
622195 Icon of kenneluniquespots.dkkenneluniquespots.dk

709230 (+87035)

622196 Icon of kenshotea.comkenshotea.com
622197 Icon of keonet.dkkeonet.dk

745064 (+122867)

622198 Icon of keresettaferi.hukeresettaferi.hu
622199 Icon of kern-sohn.comkern-sohn.com

389475 (-232724)

622200 Icon of kernekort.dkkernekort.dk
622201 Icon of keycrox.co.ukkeycrox.co.uk

248944 (-373257)

622202 Icon of keystroke.tkkeystroke.tk
622203 Icon of kfop.dkkfop.dk

612352 (-9851)

622204 Icon of kg-camping.dkkg-camping.dk

692076 (+69872)

622205 Icon of kh-technic.dkkh-technic.dk
622206 Icon of kiaevforums.comkiaevforums.com

94385 (-527821)

546884 (-75322)

622207 Icon of kiboko.dkkiboko.dk
622208 Icon of kiehls.dkkiehls.dk

659900 (+37692)

622209 Icon of kielce.uw.gov.plkielce.uw.gov.pl

633303 (+11094)

622210 Icon of kiew.pp.uakiew.pp.ua

264880 (-357330)

745078 (+122868)

622211 Icon of kiibee.dkkiibee.dk
622212 Icon of kikkertland.dkkikkertland.dk

604275 (-17937)

663454 (+41242)

622213 Icon of kildacruises.co.ukkildacruises.co.uk
622214 Icon of kingosdyreklinik.dkkingosdyreklinik.dk
622215 Icon of kira-liv.dekira-liv.de
622216 Icon of kirelabs.orgkirelabs.org

371269 (-250947)

448435 (-173781)

190829 (-431387)

622217 Icon of kirenz.comkirenz.com

683402 (+61185)

622218 Icon of kirkebygaard.dkkirkebygaard.dk

659920 (+37702)

622219 Icon of kirkenettet.dkkirkenettet.dk

476531 (-145688)

636038 (+13819)

671185 (+48966)

622220 Icon of kirkenskorshaer.dkkirkenskorshaer.dk

659921 (+37701)

622221 Icon of kirsinkirjanurkka.fikirsinkirjanurkka.fi

729387 (+107166)

622222 Icon of kissanime.tokissanime.to
622223 Icon of kissasian.netkissasian.net

709264 (+87041)

622224 Icon of kissmeliar.comkissmeliar.com

449439 (-172785)

716771 (+94547)

622225 Icon of kitchenaid.dkkitchenaid.dk
622226 Icon of kitchenradar.dkkitchenradar.dk
622227 Icon of kitemana.comkitemana.com

380737 (-241490)

622228 Icon of kiwihellenist.blogspot.comkiwihellenist.blogspot.com

511545 (-110683)

622229 Icon of kjv.dkkjv.dk

653960 (+31731)

745104 (+122875)

622230 Icon of kk-bestsellers.comkk-bestsellers.com

185336 (-436894)

97245 (-524985)

622231 Icon of kkkn.dkkkkn.dk

659936 (+37705)

740307 (+118076)

622232 Icon of kl.dkkl.dk

607894 (-14338)

655599 (+33367)

619807 (-2425)

622233 Icon of klart.ioklart.io

248534 (-373699)

94996 (-527237)

285378 (-336855)

228463 (-393770)

622234 Icon of klassetrivsel.dkklassetrivsel.dk

626171 (+3937)

622235 Icon of klatreforbund.dkklatreforbund.dk

659941 (+37706)

622236 Icon of klaveronline.dkklaveronline.dk

659943 (+37707)

622237 Icon of kle-online.dkkle-online.dk
622238 Icon of klee.dkklee.dk

604337 (-17901)

719967 (+97729)

622239 Icon of klikkentheke.comklikkentheke.com
622240 Icon of kliktopia.orgkliktopia.org
622241 Icon of klinik-jie.dkklinik-jie.dk

703985 (+81744)

622242 Icon of klinikcamillabech.dkklinikcamillabech.dk
622243 Icon of klinikslotstorvet.dkklinikslotstorvet.dk
622244 Icon of klipperiet.nuklipperiet.nu
622245 Icon of klippestuenf.dkklippestuenf.dk
622246 Icon of klubweb.dkklubweb.dk

659951 (+37705)

740315 (+118069)

622247 Icon of km.dkkm.dk

653962 (+31715)

745119 (+122872)

622248 Icon of kmbg.co.ukkmbg.co.uk
622249 Icon of kmcmusik.dkkmcmusik.dk
622250 Icon of knallertservice.dkknallertservice.dk
622251 Icon of knitgarden.dkknitgarden.dk
622252 Icon of knittingforolive.dkknittingforolive.dk

612156 (-10096)

622253 Icon of knitwedo.dkknitwedo.dk
622254 Icon of knowledgenetworks.comknowledgenetworks.com
622255 Icon of knud.bizknud.biz
622256 Icon of knudsenoghartmann.dkknudsenoghartmann.dk

653964 (+31708)

622257 Icon of kobenhavnstrup.dkkobenhavnstrup.dk
622258 Icon of koebersmaegler.dkkoebersmaegler.dk

653966 (+31708)

622259 Icon of koekkenunivers.dkkoekkenunivers.dk

585629 (-36630)

622260 Icon of kokkensvinhus.dkkokkensvinhus.dk
622261 Icon of kokkenudstyrpris.dkkokkenudstyrpris.dk

709297 (+87036)

622262 Icon of koldingselvbyg.dkkoldingselvbyg.dk
622263 Icon of koldingtattoo.dkkoldingtattoo.dk
622264 Icon of kolfoods.comkolfoods.com

398660 (-223604)

622265 Icon of kollegierneskontor.dkkollegierneskontor.dk

551764 (-70501)

640818 (+18553)

606943 (-15322)

622266 Icon of kombit.dkkombit.dk

731672 (+109406)

622267 Icon of kommaer.dkkommaer.dk

659983 (+37716)

709303 (+87036)

745142 (+122875)

622268 Icon of kommunen.dkkommunen.dk
622269 Icon of komoedie-hamburg.dekomoedie-hamburg.de

659985 (+37716)

709305 (+87036)

622270 Icon of kompat.dkkompat.dk

709307 (+87037)

622271 Icon of konektra.comkonektra.com

676382 (+54111)

622272 Icon of konfair.dkkonfair.dk
622273 Icon of konfirmandcenter.dkkonfirmandcenter.dk
622274 Icon of konfliktloesning.dkkonfliktloesning.dk

659990 (+37716)

709310 (+87036)

745147 (+122873)

622275 Icon of kongamek.dkkongamek.dk
622276 Icon of kongensgaard-odense.dkkongensgaard-odense.dk
622277 Icon of konkfurniture.comkonkfurniture.com
622278 Icon of konkurrenceregler.dkkonkurrenceregler.dk
622279 Icon of konno.dkkonno.dk
622280 Icon of konstantinobel.dkkonstantinobel.dk
622281 Icon of kontrast.dkkontrast.dk

709317 (+87036)

409555 (-212726)

622282 Icon of kordamp.orgkordamp.org
622283 Icon of korean-photoshoots.blogspot.comkorean-photoshoots.blogspot.com
622284 Icon of kornkammeret.dkkornkammeret.dk
622285 Icon of korshoej.dkkorshoej.dk
622286 Icon of korsoermarineforening.dkkorsoermarineforening.dk
622287 Icon of kortal.dkkortal.dk
622288 Icon of korthilsen.dkkorthilsen.dk

660006 (+37718)

622289 Icon of korttilmotion.dkkorttilmotion.dk
622290 Icon of koskov.dkkoskov.dk

660008 (+37718)

622291 Icon of kosmorama.orgkosmorama.org
622292 Icon of kosmostec.comkosmostec.com
622293 Icon of kost.dkkost.dk

709323 (+87030)

671186 (+48893)

622294 Icon of kpfs.dkkpfs.dk
622295 Icon of kpmulti-service.dkkpmulti-service.dk
622296 Icon of kppp.plkppp.pl
622297 Icon of kraatje.nlkraatje.nl
622298 Icon of kraess.dkkraess.dk
622299 Icon of kratomscience.eukratomscience.eu
622300 Icon of kratomshop.nlkratomshop.nl
622301 Icon of kreatit.dkkreatit.dk
622302 Icon of krigsvidenskab.dkkrigsvidenskab.dk

660023 (+37721)

622303 Icon of krise-center.dkkrise-center.dk
622304 Icon of kroegerhallam.comkroegerhallam.com
622305 Icon of kromann.infokromann.info
622306 Icon of kroneborg.dkkroneborg.dk
622307 Icon of kronstadtrevolt.comkronstadtrevolt.com

709341 (+87034)

622308 Icon of kruso.dkkruso.dk

635114 (+12806)

622309 Icon of krystalfuge.dkkrystalfuge.dk
622310 Icon of ksdh.dkksdh.dk
622311 Icon of kuechenfachmarkt-shop.dekuechenfachmarkt-shop.de
622312 Icon of kufferten.dkkufferten.dk
622313 Icon of kuffertthomsen.dkkuffertthomsen.dk

660038 (+37725)

622314 Icon of kulturarv.dkkulturarv.dk

483079 (-139235)

745187 (+122873)

622315 Icon of kulturoginformation.dkkulturoginformation.dk
622316 Icon of kunde-co.comkunde-co.com
622317 Icon of kunmors.dkkunmors.dk

660045 (+37728)

704003 (+81686)

745192 (+122875)

622318 Icon of kunsten.dkkunsten.dk

660046 (+37728)

697299 (+74981)

622319 Icon of kunsten.nukunsten.nu

487133 (-135186)

614172 (-8147)

740334 (+118015)

622320 Icon of kunstogkokkentoj.dkkunstogkokkentoj.dk

607904 (-14416)

638300 (+15980)

622321 Icon of kunstogkrea.dkkunstogkrea.dk
622322 Icon of kuntzanimation.dkkuntzanimation.dk

660050 (+37728)

622323 Icon of kupon-kode.comkupon-kode.com
622324 Icon of kurdipedia.orgkurdipedia.org

142984 (-479340)

620503 (-1821)

622325 Icon of kurseroguddannelser.dkkurseroguddannelser.dk
622326 Icon of kursusfabrikken.dkkursusfabrikken.dk

604339 (-17987)

709360 (+87034)

740339 (+118013)

622327 Icon of kvik.dkkvik.dk

660053 (+37726)

709363 (+87036)

632674 (+10347)

622328 Icon of kwbruun.comkwbruun.com

653992 (+31664)

622329 Icon of kxzpfuzijjxakubmeuhu.supabase.cokxzpfuzijjxakubmeuhu.supabase.co
622330 Icon of kyawsan7.blogspot.comkyawsan7.blogspot.com
622331 Icon of kyst.dkkyst.dk

695582 (+73251)

622332 Icon of kyster-marine.dkkyster-marine.dk
622333 Icon of la-bottega.dkla-bottega.dk

731682 (+109349)

622334 Icon of laby.netlaby.net

668991 (+46657)

580987 (-41347)

547740 (-74594)

622335 Icon of lacabra.dklacabra.dk

307628 (-314707)

487848 (-134487)

622336 Icon of lacedrecords.colacedrecords.co

318516 (-303820)

622337 Icon of ladegustationdomu.czladegustationdomu.cz
622338 Icon of ladenstein.atladenstein.at
622339 Icon of laegepernielsen.dklaegepernielsen.dk
622340 Icon of laegerneiskovby.dklaegerneiskovby.dk
622341 Icon of laegernelouiseplads.dklaegernelouiseplads.dk
622342 Icon of lafresca.dklafresca.dk
622343 Icon of lagur.dklagur.dk
622344 Icon of lakridsbybulow.comlakridsbybulow.com

699963 (+77619)

622345 Icon of laligaexpert.comlaligaexpert.com

285173 (-337172)

622346 Icon of lamilanaise.comlamilanaise.com
622347 Icon of lammeskindet.dklammeskindet.dk
622348 Icon of lammeuld.dklammeuld.dk

731689 (+109341)

622349 Icon of lampemania.dklampemania.dk

660086 (+37737)

599093 (-23256)

509203 (-113146)

622350 Icon of land8.comland8.com

660087 (+37737)

217598 (-404752)

547946 (-74404)

622351 Icon of landekoder.dklandekoder.dk
622352 Icon of landevejscykling.dklandevejscykling.dk
622353 Icon of landkreis-straubing-bogen.delandkreis-straubing-bogen.de
622354 Icon of landmarkmedical.orglandmarkmedical.org
622355 Icon of landogfritid.dklandogfritid.dk

588794 (-33561)

636041 (+13686)

740353 (+117998)

622356 Icon of landskronahem.selandskronahem.se

660090 (+37734)

709403 (+87047)

745255 (+122899)

622357 Icon of landsskuet.dklandsskuet.dk
622358 Icon of landsyd.dklandsyd.dk
622359 Icon of langelandsfestival.dklangelandsfestival.dk
622360 Icon of langhoej.dklanghoej.dk

645446 (+23086)

622361 Icon of langsamt.comlangsamt.com
622362 Icon of langworkholding.ielangworkholding.ie
622363 Icon of lantorcomposites.comlantorcomposites.com
622364 Icon of laptoplivsstil.comlaptoplivsstil.com
622365 Icon of laptopvision.nllaptopvision.nl

489360 (-133005)

622366 Icon of larm.fmlarm.fm
622367 Icon of larsen-tamborg.dklarsen-tamborg.dk
622368 Icon of laserfoto.dklaserfoto.dk

550427 (-71941)

622369 Icon of laserfreak.netlaserfreak.net
622370 Icon of laserpower.dklaserpower.dk
622371 Icon of lasertech.comlasertech.com

654001 (+31630)

622372 Icon of lashclinic.dklashclinic.dk
622373 Icon of lastbilgalleri.dklastbilgalleri.dk
622374 Icon of latequilabar.dklatequilabar.dk

671188 (+48814)

622375 Icon of latexcatfish.comlatexcatfish.com

354275 (-268100)

678911 (+56536)

492785 (-129590)

622376 Icon of latexdraw.comlatexdraw.com

595575 (-26801)

706137 (+83761)

622377 Icon of latinoguysporn.comlatinoguysporn.com
622378 Icon of latinskordbog.dklatinskordbog.dk

597872 (-24506)

622379 Icon of laudrup.dklaudrup.dk

745269 (+122890)

622380 Icon of lauenstein.dklauenstein.dk
622381 Icon of laundryheap.dklaundryheap.dk
622382 Icon of laurelandhardycentral.comlaurelandhardycentral.com
622383 Icon of lauritz.dklauritz.dk

704018 (+81635)

622384 Icon of lavosingapore.comlavosingapore.com

598317 (-24067)

688689 (+66305)

622385 Icon of lavpris-laase.dklavpris-laase.dk

709418 (+87033)

740358 (+117973)

622386 Icon of lawicel.selawicel.se
622387 Icon of laytheme.comlaytheme.com

635123 (+12736)

622388 Icon of lbforsikring-pfa.dklbforsikring-pfa.dk
622389 Icon of lbphone.comlbphone.com

654008 (+31619)

622390 Icon of lbs-b-o.dklbs-b-o.dk
622391 Icon of lbtechreviews.comlbtechreviews.com

366353 (-256038)

626079 (+3688)

622392 Icon of le34.dkle34.dk
622393 Icon of leadersedge.comleadersedge.com
622394 Icon of leadhub.dkleadhub.dk

681956 (+59562)

622395 Icon of leadscloud.github.ioleadscloud.github.io
622396 Icon of leakedcelebritynudes.comleakedcelebritynudes.com

72760 (-549636)

448822 (-173574)

622397 Icon of leaveamarkgroup.comleaveamarkgroup.com
622398 Icon of lebeddie.comlebeddie.com
622399 Icon of leckl.dkleckl.dk
622400 Icon of lecoinfamille.comlecoinfamille.com
622401 Icon of lederstof.dklederstof.dk

549693 (-72708)

622402 Icon of lef.dklef.dk

645450 (+23048)

677360 (+54958)

622403 Icon of lefeufires.dklefeufires.dk

604343 (-18060)

622404 Icon of leftbrainedartist.comleftbrainedartist.com

340643 (-281761)

622405 Icon of legarts.toplegarts.top
622406 Icon of legekammeraten.dklegekammeraten.dk

660126 (+37720)

622407 Icon of legeslottet.dklegeslottet.dk
622408 Icon of leglas.dkleglas.dk

745298 (+122890)

622409 Icon of lego.dklego.dk
622410 Icon of legopages.comlegopages.com
622411 Icon of leiflarsenmarine.dkleiflarsenmarine.dk
622412 Icon of lejanlaeg.dklejanlaeg.dk

745304 (+122892)

622413 Icon of lejeboligen.nulejeboligen.nu

635126 (+12713)

692085 (+69672)

622414 Icon of lekon.dklekon.dk
622415 Icon of lemariva.comlemariva.com

450486 (-171929)

622416 Icon of lemmecheck.xxxlemmecheck.xxx

450489 (-171927)

622417 Icon of lemvig.dklemvig.dk
622418 Icon of lens-db.comlens-db.com
622419 Icon of leopharma.sharepoint.comleopharma.sharepoint.com

660140 (+37721)

622420 Icon of les-lundis-daltor.comles-lundis-daltor.com

158720 (-463700)

323507 (-298913)

622421 Icon of lesaintjacques.dklesaintjacques.dk
622422 Icon of lesley.edulesley.edu

201823 (-420599)

134202 (-488220)

110381 (-512041)

622423 Icon of lessonslearnedinlife.comlessonslearnedinlife.com

160003 (-462420)

206108 (-416315)

622424 Icon of letstalksap.comletstalksap.com
622425 Icon of letusprint.dkletusprint.dk

691826 (+69401)

622426 Icon of levbedre.dklevbedre.dk

709470 (+87044)

622427 Icon of lexa-pferdefutter.atlexa-pferdefutter.at
622428 Icon of lexanordic.comlexanordic.com
622429 Icon of lgbt.dklgbt.dk

709474 (+87045)

745328 (+122899)

622430 Icon of lhvmaler.dklhvmaler.dk
622431 Icon of liamrosen.comliamrosen.com

660159 (+37728)

718096 (+95665)

622432 Icon of liberte.plliberte.pl

517023 (-105409)

622433 Icon of librairiesaga.calibrairiesaga.ca

709478 (+87045)

622434 Icon of lichtdekor.delichtdekor.de
622435 Icon of liczebnik.plliczebnik.pl

496023 (-126412)

345600 (-276835)

622436 Icon of lifeonnetwork.comlifeonnetwork.com

548984 (-73452)

622437 Icon of ligasport.dkligasport.dk

660172 (+37735)

622438 Icon of lightbooth.dklightbooth.dk
622439 Icon of lightbuzz.comlightbuzz.com
622440 Icon of likeaboss.nulikeaboss.nu

709493 (+87053)

622441 Icon of likeanna.dklikeanna.dk
622442 Icon of likvido.comlikvido.com

349852 (-272590)

622443 Icon of lillekleo.wordpress.comlillekleo.wordpress.com
622444 Icon of lillenova.dklillenova.dk
622445 Icon of lillevildmose.dklillevildmose.dk

704028 (+81583)

622446 Icon of lime-technologies.comlime-technologies.com

664529 (+42083)

622447 Icon of limfjordupdate.dklimfjordupdate.dk
622448 Icon of limiter.co.krlimiter.co.kr
622449 Icon of lindaontherun.comlindaontherun.com

410183 (-212266)

622450 Icon of lindellrecoverynetwork.orglindellrecoverynetwork.org
622451 Icon of lindvedel.dklindvedel.dk

745356 (+122905)

622452 Icon of lineagelogistics.comlineagelogistics.com

248936 (-373516)

300219 (-322233)

242470 (-379982)

622453 Icon of lingualinx.comlingualinx.com

402977 (-219476)

622454 Icon of linguee.dklinguee.dk
622455 Icon of linux-hardware.orglinux-hardware.org

450862 (-171593)

331806 (-290649)

117807 (-504648)

404253 (-218202)

622456 Icon of linux-tips.uslinux-tips.us
622457 Icon of linuxstans.comlinuxstans.com

669101 (+46644)

718128 (+95671)

318627 (-303830)

622458 Icon of lionpizza.dklionpizza.dk
622459 Icon of lisaekdahl.comlisaekdahl.com
622460 Icon of liskasper.dkliskasper.dk
622461 Icon of litteraturlisteautomaten.dklitteraturlisteautomaten.dk

709515 (+87054)

622462 Icon of littlehappy.dklittlehappy.dk
622463 Icon of littlehappyfamily.dklittlehappyfamily.dk
622464 Icon of liuteriabruma.comliuteriabruma.com
622465 Icon of livearico.eulivearico.eu
622466 Icon of livegps.dklivegps.dk

660210 (+37744)

661824 (+39358)

622467 Icon of livejazz.dklivejazz.dk

745368 (+122901)

622468 Icon of liveklassisk.comliveklassisk.com
622469 Icon of livemag.itlivemag.it
622470 Icon of livetsomsenior.dklivetsomsenior.dk

660214 (+37744)

695597 (+73127)

622471 Icon of livewelly.colivewelly.co
622472 Icon of livingcleanwater.dklivingcleanwater.dk

745373 (+122901)

622473 Icon of livingonabudget.dklivingonabudget.dk

731705 (+109232)

622474 Icon of livingshop.dklivingshop.dk

678610 (+56136)

622475 Icon of livogsimone.dklivogsimone.dk
622476 Icon of liwfrontiergirl.comliwfrontiergirl.com

709526 (+87050)

622477 Icon of ljbronce.dkljbronce.dk
622478 Icon of ljmontage.dkljmontage.dk

740379 (+117901)

622479 Icon of lmfit-py.readthedocs.iolmfit-py.readthedocs.io
622480 Icon of lms.dklms.dk
622481 Icon of lmtmag.comlmtmag.com
622482 Icon of lndry.applndry.app
622483 Icon of loadedshop.netloadedshop.net

695599 (+73116)

745385 (+122902)

622484 Icon of loandenmark.dkloandenmark.dk

660224 (+37740)

745387 (+122903)

622485 Icon of lobir.linklobir.link

660225 (+37740)

709535 (+87050)

745388 (+122903)

622486 Icon of localhussies.comlocalhussies.com

380354 (-242132)

449130 (-173356)

539131 (-83355)

622487 Icon of loesoe.nlloesoe.nl

663823 (+41336)

622488 Icon of loeveapotek.dkloeveapotek.dk
622489 Icon of loft-lamper.dkloft-lamper.dk
622490 Icon of logaretm.comlogaretm.com

439408 (-183082)

549695 (-72795)

149247 (-473243)

622491 Icon of logb.dklogb.dk
622492 Icon of logic-case.comlogic-case.com
622493 Icon of lokalboligprojekt.dklokalboligprojekt.dk
622494 Icon of lollylegs.comlollylegs.com
622495 Icon of lolobloom.dklolobloom.dk
622496 Icon of lolprofile.netlolprofile.net

209519 (-412977)

545972 (-76524)

268478 (-354018)

622497 Icon of lolsketch.comlolsketch.com

327116 (-295381)

745401 (+122904)

622498 Icon of lommelygtesalg.dklommelygtesalg.dk

654047 (+31549)

622499 Icon of lommyfleet.comlommyfleet.com

660229 (+37730)

622500 Icon of lonebrinkmann.dklonebrinkmann.dk

709552 (+87052)