Alexa Top 530001 – 530500 Most Visited Websites – Most Popular Sites List 2022

Based on data from the Alexa rank, this page reveals the Alexa Top 530001 – 530500 most visited websites. We will be updating this list daily, so you can keep track of all the market shifts and spot changes in user interest.

powertochange.org.au is the top 530001 – 530500 most visited website in the world in 06/12/2022, who’s rank went down, while the second-placed pracworks.com.my stayed the same in the same period. prestidge.com.au also performed well.

Depending on the methodology used, the results can have significant variability. However, having a reasonably accurate list is beneficial to the many use cases these lists can be applied to.

Alexa Top 530001 – 530500 Domain List

Alexa Top 530001 – 530500 Websites Ranking data updated according to the most recent updated in 06/12/2022.

Rank Domain Yesterday Last week Last month Last year
530001 Icon of powertochange.org.aupowertochange.org.au

465961 (-64040)

530002 Icon of pracworks.com.mypracworks.com.my
530003 Icon of prestidge.com.auprestidge.com.au
530004 Icon of printapromo.com.auprintapromo.com.au

480453 (-49551)

530005 Icon of proactivehealthandsports.com.auproactivehealthandsports.com.au
530006 Icon of profile.ruprofile.ru

114490 (-415516)

620001 (+89995)

111908 (-418098)

530007 Icon of propertyregistry.com.aupropertyregistry.com.au

490495 (-39512)

530008 Icon of prospectphysioandhealthplus.comprospectphysioandhealthplus.com
530009 Icon of protecht.com.auprotecht.com.au

555046 (+25037)

530010 Icon of psychic-junkie.compsychic-junkie.com

394851 (-135159)

571172 (+41162)

135644 (-394366)

530011 Icon of publicpressure.iopublicpressure.io

463397 (-66614)

530012 Icon of punchwithjudy.com.aupunchwithjudy.com.au

531723 (+1711)

665283 (+135271)

530013 Icon of pupnaps.compupnaps.com

285419 (-244594)

597262 (+67249)

36876 (-493137)

530014 Icon of pureweb.compureweb.com

267876 (-262138)

530015 Icon of qaa.comqaa.com
530016 Icon of qinetiq.comqinetiq.com

555061 (+25045)

211552 (-318464)

530017 Icon of qinetiq.com.auqinetiq.com.au

534027 (+4010)

530018 Icon of qkrschool.comqkrschool.com
530019 Icon of qlv.com.auqlv.com.au
530020 Icon of queenslandrail.sharepoint.comqueenslandrail.sharepoint.com

244030 (-285990)

530021 Icon of quickernotes2.comquickernotes2.com
530022 Icon of quitclinics.comquitclinics.com

316552 (-213470)

597320 (+67298)

530023 Icon of qutguild.comqutguild.com

370180 (-159843)

597325 (+67302)

610190 (+80167)

530024 Icon of r-spatial.github.ior-spatial.github.io

392747 (-137277)

530025 Icon of radford.act.edu.auradford.act.edu.au

610207 (+80182)

530026 Icon of radtronics.com.auradtronics.com.au
530027 Icon of rainesquare.com.aurainesquare.com.au
530028 Icon of razorelectrical.com.aurazorelectrical.com.au
530029 Icon of recoveriescorp.com.aurecoveriescorp.com.au

501667 (-28362)

530030 Icon of redarc.com.auredarc.com.au

491241 (-38789)

597415 (+67385)

673374 (+143344)

135658 (-394372)

530031 Icon of reefsecrets.com.aureefsecrets.com.au
530032 Icon of regattahotel.com.auregattahotel.com.au

610331 (+80299)

530033 Icon of reliancebank.com.aureliancebank.com.au
530034 Icon of rentalrecon.comrentalrecon.com

62332 (-467702)

530035 Icon of replacementcarkeys.com.aureplacementcarkeys.com.au

399579 (-130456)

530036 Icon of replaybankstown.comreplaybankstown.com
530037 Icon of resourcepacks24.deresourcepacks24.de

365375 (-164662)

124803 (-405234)

530038 Icon of retrogames.onlretrogames.onl

181342 (-348696)

274590 (-255448)

578094 (+48056)

196181 (-333857)

530039 Icon of revengebasketball.comrevengebasketball.com
530040 Icon of revex4.com.aurevex4.com.au

597499 (+67459)

490537 (-39503)

530041 Icon of revu.com.phrevu.com.ph

529773 (-268)

401437 (-128604)

530042 Icon of rhinocrm.com.aurhinocrm.com.au
530043 Icon of richdatahub.iorichdatahub.io

466004 (-64039)

530044 Icon of ritepriceheatingcooling.com.auritepriceheatingcooling.com.au

597540 (+67496)

530045 Icon of riteq.com.auriteq.com.au

195745 (-334300)

58233 (-471812)

530046 Icon of rivaresorts.comrivaresorts.com
530047 Icon of roadfreightnsw.com.auroadfreightnsw.com.au
530048 Icon of roadpass.comroadpass.com

445911 (-84137)

555102 (+25054)

214357 (-315691)

530049 Icon of roadtechmarine.com.auroadtechmarine.com.au

480539 (-49510)

294237 (-235812)

288678 (-241371)

530050 Icon of robertgiededesign.comrobertgiededesign.com
530051 Icon of robhasawebsite.comrobhasawebsite.com
530052 Icon of rodlaverarena.com.aurodlaverarena.com.au

301500 (-228552)

530053 Icon of roidprices.comroidprices.com

483016 (-47037)

361308 (-168745)

530054 Icon of rolan.com.aurolan.com.au

288924 (-241130)

392931 (-137123)

530055 Icon of rolld.com.aurolld.com.au

597582 (+67527)

530056 Icon of ros.gov.ukros.gov.uk

641990 (+111934)

530057 Icon of rosamexicano.com.aurosamexicano.com.au
530058 Icon of rosterportal.com.aurosterportal.com.au
530059 Icon of rotem-radiation.co.ilrotem-radiation.co.il
530060 Icon of rouxgroup.org.ukrouxgroup.org.uk
530061 Icon of rowvillepac.comrowvillepac.com
530062 Icon of royhill.com.auroyhill.com.au
530063 Icon of rpmrcproducts.comrpmrcproducts.com
530064 Icon of rrepp.com.aurrepp.com.au
530065 Icon of rsarcg.com.aursarcg.com.au
530066 Icon of rubbishtips.com.aurubbishtips.com.au
530067 Icon of ruggedphonestore.com.auruggedphonestore.com.au
530068 Icon of rvsalesaus.com.aurvsalesaus.com.au
530069 Icon of saemc.com.ausaemc.com.au

597662 (+67593)

530070 Icon of sagaenmore.comsagaenmore.com
530071 Icon of sail-croatia.comsail-croatia.com

480569 (-49502)

553721 (+23650)

530072 Icon of salisbury.sa.gov.ausalisbury.sa.gov.au
530073 Icon of samphirerottnest.com.ausamphirerottnest.com.au
530074 Icon of santegroup365.sharepoint.comsantegroup365.sharepoint.com
530075 Icon of satin.com.ausatin.com.au
530076 Icon of sayhi.comsayhi.com

551721 (+21645)

530077 Icon of scamwarners.comscamwarners.com

77761 (-452316)

660192 (+130115)

530078 Icon of scarborotoyota.com.auscarborotoyota.com.au
530079 Icon of sccmelb.catholic.edu.ausccmelb.catholic.edu.au
530080 Icon of scenetobelieve.com.auscenetobelieve.com.au

264620 (-265460)

555761 (+25681)

530081 Icon of scentregroup.sharepoint.comscentregroup.sharepoint.com

396053 (-134028)

610661 (+80580)

530082 Icon of schoolactivities.com.auschoolactivities.com.au
530083 Icon of schoolholidaydirectory.com.auschoolholidaydirectory.com.au
530084 Icon of scoutrfp.comscoutrfp.com

65789 (-464295)

530085 Icon of scyo.org.auscyo.org.au

610713 (+80628)

530086 Icon of sdbmovie.comsdbmovie.com
530087 Icon of seabreezebeachhotel.com.auseabreezebeachhotel.com.au
530088 Icon of seascape.com.auseascape.com.au
530089 Icon of secrethqcomics.com.ausecrethqcomics.com.au
530090 Icon of securemaxxia.com.ausecuremaxxia.com.au

394894 (-135196)

356729 (-173361)

316026 (-214064)

530091 Icon of seedmob.org.auseedmob.org.au
530092 Icon of seedsavers.netseedsavers.net
530093 Icon of seekjobs-my.sharepoint.comseekjobs-my.sharepoint.com

405617 (-124476)

530094 Icon of selfsufficientaus.com.auselfsufficientaus.com.au
530095 Icon of sendmoneynepal.com.ausendmoneynepal.com.au

555151 (+25056)

530096 Icon of serv.com.auserv.com.au

276636 (-253460)

530097 Icon of servicestream.com.auservicestream.com.au

480601 (-49496)

555153 (+25056)

530098 Icon of ses.sa.gov.auses.sa.gov.au
530099 Icon of shadeprotocol.ioshadeprotocol.io
530100 Icon of shellharbourcitycouncil-my.sharepoint.comshellharbourcitycouncil-my.sharepoint.com
530101 Icon of shellharbourciviccentre.com.aushellharbourciviccentre.com.au
530102 Icon of sherriffcontractors.com.ausherriffcontractors.com.au
530103 Icon of sherwagyu.com.ausherwagyu.com.au
530104 Icon of shloimezacks.wixsite.comshloimezacks.wixsite.com
530105 Icon of shootingandsafety.comshootingandsafety.com
530106 Icon of shop-innovations-4993.myshopify.comshop-innovations-4993.myshopify.com
530107 Icon of shop-magnamund.comshop-magnamund.com
530108 Icon of shopfully.com.aushopfully.com.au

502070 (-28038)

335043 (-195065)

573690 (+43582)

258272 (-271836)

530109 Icon of shopmotf.comshopmotf.com

204852 (-325257)

393192 (-136917)

530110 Icon of shoppingcentrenews.com.aushoppingcentrenews.com.au

412301 (-117809)

196266 (-333844)

530111 Icon of shortrightlegsyndrome.comshortrightlegsyndrome.com

573692 (+43581)

530112 Icon of siamzone.comsiamzone.com

222701 (-307411)

121877 (-408235)

240627 (-289485)

135282 (-394830)

530113 Icon of silverskinsrepository.tumblr.comsilverskinsrepository.tumblr.com
530114 Icon of simplotgrowersolutions.comsimplotgrowersolutions.com
530115 Icon of sirjosephb-h.schools.nsw.edu.ausirjosephb-h.schools.nsw.edu.au
530116 Icon of sixense-group.com.ausixense-group.com.au
530117 Icon of skijapan.comskijapan.com

490614 (-39503)

530118 Icon of skinpartners.com.auskinpartners.com.au
530119 Icon of skylx.siteskylx.site

470553 (-59566)

447334 (-82785)

530120 Icon of slotcarracing.org.ukslotcarracing.org.uk
530121 Icon of smartazan.comsmartazan.com

502164 (-27957)

530122 Icon of smithbot.comsmithbot.com

168695 (-361427)

530123 Icon of smokedandcured.com.ausmokedandcured.com.au

502181 (-27942)

87350 (-442773)

530124 Icon of smzb2022.comsmzb2022.com

405635 (-124489)

530125 Icon of sneakerlab.comsneakerlab.com
530126 Icon of snek7986.workers.devsnek7986.workers.dev

571429 (+41303)

530127 Icon of socialrabbitplugin.comsocialrabbitplugin.com

269469 (-260658)

530128 Icon of socialspace.com.ausocialspace.com.au

246085 (-284043)

530129 Icon of softnyx-mena.comsoftnyx-mena.com
530130 Icon of solarcalculator.com.ausolarcalculator.com.au

300537 (-229593)

490631 (-39499)

530131 Icon of sopheon.netsopheon.net

480650 (-49481)

622543 (+92412)

530132 Icon of sordaustralia.comsordaustralia.com
530133 Icon of sosna.com.ausosna.com.au
530134 Icon of source-chunk.github.iosource-chunk.github.io
530135 Icon of southerneducation.com.ausoutherneducation.com.au
530136 Icon of sparkplus.com.ausparkplus.com.au

490640 (-39496)

530137 Icon of spartanslotslive.comspartanslotslive.com
530138 Icon of spearfishing.com.auspearfishing.com.au

139035 (-391103)

675465 (+145327)

530139 Icon of spectra-vision.comspectra-vision.com

99048 (-431091)

415884 (-114255)

530140 Icon of speedcargames.comspeedcargames.com

405648 (-124492)

530141 Icon of speedtwitch.comspeedtwitch.com
530142 Icon of sqinsights.comsqinsights.com

405652 (-124490)

555216 (+25074)

530143 Icon of squarewave.com.ausquarewave.com.au
530144 Icon of srv40.comsrv40.com
530145 Icon of sskb.com.ausskb.com.au
530146 Icon of stagehypnosisuniversity.comstagehypnosisuniversity.com
530147 Icon of starrpartners.com.austarrpartners.com.au

480676 (-49471)

598229 (+68082)

530148 Icon of statelibrarynsw.sharepoint.comstatelibrarynsw.sharepoint.com

370190 (-159958)

611207 (+81059)

530149 Icon of statsbomb.comstatsbomb.com

306829 (-223320)

611211 (+81062)

530150 Icon of stayelite.com.austayelite.com.au
530151 Icon of steakministry.com.austeakministry.com.au

571483 (+41332)

530152 Icon of stephgorton.comstephgorton.com
530153 Icon of stevehoggbikefitting.comstevehoggbikefitting.com
530154 Icon of stickybottle.com.austickybottle.com.au
530155 Icon of stickyricecookingschool.com.austickyricecookingschool.com.au
530156 Icon of stix.com.austix.com.au
530157 Icon of stoneworkspavers.com.austoneworkspavers.com.au
530158 Icon of strataandco.com.austrataandco.com.au

480695 (-49463)

530159 Icon of streamlinepanel.comstreamlinepanel.com

502361 (-27798)

660059 (+129900)

430609 (-99550)

530160 Icon of stretchitbodyjewellery.co.ukstretchitbodyjewellery.co.uk
530161 Icon of studioamelia.costudioamelia.co
530162 Icon of styletread.com.austyletread.com.au

247718 (-282444)

202759 (-327403)

384968 (-145194)

530163 Icon of sukworkwear.com.ausukworkwear.com.au
530164 Icon of sungroupcomvn-my.sharepoint.comsungroupcomvn-my.sharepoint.com

328273 (-201891)

344407 (-185757)

530165 Icon of sunniscenes.comsunniscenes.com

502406 (-27759)

611350 (+81185)

530166 Icon of sunshoweronline.com.ausunshoweronline.com.au

269888 (-260278)

534116 (+3950)

490683 (-39483)

530167 Icon of supersprint.comsupersprint.com

371406 (-158761)

239466 (-290701)

530168 Icon of supremeheating.com.ausupremeheating.com.au
530169 Icon of suprent-us.comsuprent-us.com
530170 Icon of suzukiqld.com.ausuzukiqld.com.au

598396 (+68226)

461872 (-68298)

530171 Icon of suzymchale.comsuzymchale.com
530172 Icon of swamp.net.auswamp.net.au

174586 (-355586)

421016 (-109156)

530173 Icon of swamyayyappatravels.inswamyayyappatravels.in
530174 Icon of swissport.com.auswissport.com.au

239776 (-290398)

466089 (-64085)

530175 Icon of sydchiro.ausydchiro.au
530176 Icon of sydneyharboursurfclub.com.ausydneyharboursurfclub.com.au
530177 Icon of sydneynewyearseve.comsydneynewyearseve.com

463447 (-66730)

109534 (-420643)

530178 Icon of sydneypackaging.com.ausydneypackaging.com.au
530179 Icon of symbionhealth.comsymbionhealth.com

356744 (-173435)

214422 (-315757)

530180 Icon of symbioticsltd.comsymbioticsltd.com
530181 Icon of syncsort.comsyncsort.com
530182 Icon of tafegippsland.edu.autafegippsland.edu.au

414771 (-115411)

530183 Icon of tailrunner.comtailrunner.com
530184 Icon of talkedaboutmarketing.comtalkedaboutmarketing.com

379824 (-150360)

534128 (+3944)

530185 Icon of tantdavenir.comtantdavenir.com
530186 Icon of tanthrough.comtanthrough.com
530187 Icon of tarampahotel.com.autarampahotel.com.au
530188 Icon of targum.infotargum.info
530189 Icon of tatanatransport.com.autatanatransport.com.au
530190 Icon of tbsm.com.autbsm.com.au

594027 (+63837)

598505 (+68315)

530191 Icon of tcc.nsw.edu.autcc.nsw.edu.au
530192 Icon of teachenglishonline.com.auteachenglishonline.com.au
530193 Icon of teadrop.com.auteadrop.com.au
530194 Icon of techboxaustralia.com.autechboxaustralia.com.au
530195 Icon of techxspace.com.autechxspace.com.au
530196 Icon of tekglow.comtekglow.com
530197 Icon of tellemstevedave.comtellemstevedave.com
530198 Icon of tellmeatalegreatorsmall.blogspot.comtellmeatalegreatorsmall.blogspot.com
530199 Icon of telstrahealth.comtelstrahealth.com

424413 (-105786)

530200 Icon of tennisinstruction.comtennisinstruction.com
530201 Icon of tensens.com.autensens.com.au
530202 Icon of thanhlinh.netthanhlinh.net

364768 (-165434)

199073 (-331129)

271244 (-258958)

530203 Icon of the-lowdown.comthe-lowdown.com

343464 (-186739)

530204 Icon of the-wellington-sandals.myshopify.comthe-wellington-sandals.myshopify.com
530205 Icon of theagrariankitchen.comtheagrariankitchen.com

639718 (+109513)

530206 Icon of theboardgamer.com.autheboardgamer.com.au

502634 (-27572)

461031 (-69175)

530207 Icon of thebraineducation.com.authebraineducation.com.au

394956 (-135251)

530208 Icon of thecaryard.com.authecaryard.com.au
530209 Icon of thedupespot.com.authedupespot.com.au
530210 Icon of thefamilycook.com.authefamilycook.com.au
530211 Icon of thefeistylizard.com.authefeistylizard.com.au

611694 (+81483)

530212 Icon of thegarageflats.myshopify.comthegarageflats.myshopify.com

573921 (+43709)

530213 Icon of thegstore.com.authegstore.com.au
530214 Icon of thehillsperio.com.authehillsperio.com.au
530215 Icon of thelasercutshop.com.authelasercutshop.com.au
530216 Icon of thenailest.comthenailest.com

240602 (-289614)

530217 Icon of thenbs.comthenbs.com

89451 (-440766)

138416 (-391801)

296577 (-233640)

530218 Icon of thenourishnook.com.authenourishnook.com.au
530219 Icon of theobesitycollective.sharepoint.comtheobesitycollective.sharepoint.com

555308 (+25089)

530220 Icon of theoffgridshop.com.autheoffgridshop.com.au
530221 Icon of theosdeli.com.autheosdeli.com.au
530222 Icon of thepiratebay.ggthepiratebay.gg

413214 (-117008)

530223 Icon of thereliableteam.com.authereliableteam.com.au
530224 Icon of thesapphire.comthesapphire.com
530225 Icon of theshoebar.com.autheshoebar.com.au
530226 Icon of thesleepstore.com.authesleepstore.com.au
530227 Icon of thesoulfoodpot.comthesoulfoodpot.com

453781 (-76446)

568723 (+38496)

530228 Icon of thespringboklodge.co.zathespringboklodge.co.za
530229 Icon of thesuperfoodclub.comthesuperfoodclub.com
530230 Icon of thetableclub.comthetableclub.com
530231 Icon of thetimberline.com.authetimberline.com.au
530232 Icon of theundone.comtheundone.com

502790 (-27442)

458425 (-71807)

680079 (+149847)

530233 Icon of theveininstitute.sharepoint.comtheveininstitute.sharepoint.com
530234 Icon of thewattleroad.com.authewattleroad.com.au
530235 Icon of thewoollysheep.com.authewoollysheep.com.au
530236 Icon of thinkcreativestudios.comthinkcreativestudios.com
530237 Icon of thirdwheelcycling.comthirdwheelcycling.com
530238 Icon of thirstycamelonline.com.authirstycamelonline.com.au
530239 Icon of tigerbrokers.com.hktigerbrokers.com.hk
530240 Icon of timelybusinesssolutions.com.autimelybusinesssolutions.com.au
530241 Icon of timetrade.com.autimetrade.com.au

457272 (-72969)

530242 Icon of titandms.com.autitandms.com.au
530243 Icon of tjm.com.autjm.com.au

269890 (-260353)

423233 (-107010)

530244 Icon of tomatina.estomatina.es
530245 Icon of tommorowwhat.krtommorowwhat.kr

29278 (-500967)

530246 Icon of tonyristorante.ittonyristorante.it
530247 Icon of toottoottoys.com.autoottoottoys.com.au
530248 Icon of top-games.nettop-games.net

502861 (-27387)

279770 (-250478)

123718 (-406530)

530249 Icon of totl.nettotl.net

405722 (-124527)

555344 (+25095)

530250 Icon of tradewithmecommunity.comtradewithmecommunity.com

555350 (+25100)

329056 (-201194)

530251 Icon of trafficzipper.comtrafficzipper.com

502907 (-27344)

461041 (-69210)

382526 (-147725)

530252 Icon of trainingschool.com.autrainingschool.com.au
530253 Icon of travelbrochures.com.autravelbrochures.com.au
530254 Icon of travelodge.com.autravelodge.com.au

568830 (+38576)

680189 (+149935)

530255 Icon of treetopsadventure.com.autreetopsadventure.com.au
530256 Icon of trelleborg.sharepoint.comtrelleborg.sharepoint.com

140809 (-389447)

530257 Icon of tribetravel.com.autribetravel.com.au
530258 Icon of tropagconference.orgtropagconference.org
530259 Icon of tsagroup.com.autsagroup.com.au
530260 Icon of tsch.org.autsch.org.au
530261 Icon of ttggolfclub.com.auttggolfclub.com.au

502974 (-27287)

463473 (-66788)

530262 Icon of tungsteninsurance.com.autungsteninsurance.com.au
530263 Icon of twodeerscafe.comtwodeerscafe.com
530264 Icon of u3awaverley.org.auu3awaverley.org.au
530265 Icon of ugreen.com.pkugreen.com.pk

355389 (-174876)

473322 (-56943)

530266 Icon of ultimatecentral.comultimatecentral.com

680271 (+150005)

530267 Icon of ultratrailaustralia.com.auultratrailaustralia.com.au

444187 (-86080)

530268 Icon of unicorncheese.com.auunicorncheese.com.au
530269 Icon of unihost.com.auunihost.com.au
530270 Icon of uniparks-my.sharepoint.comuniparks-my.sharepoint.com
530271 Icon of unisaarlandde-my.sharepoint.comunisaarlandde-my.sharepoint.com
530272 Icon of unsw.counsw.co

394980 (-135292)

534189 (+3917)

530273 Icon of unusual.co.ukunusual.co.uk
530274 Icon of up.com.auup.com.au

371116 (-159158)

188379 (-341895)

530275 Icon of urban-xtreme.com.auurban-xtreme.com.au
530276 Icon of urbangriller.comurbangriller.com
530277 Icon of urc.tvurc.tv
530278 Icon of usasa.sa.edu.auusasa.sa.edu.au
530279 Icon of v8peoplestreme.netv8peoplestreme.net

157772 (-372507)

461911 (-68368)

530280 Icon of vac.org.auvac.org.au
530281 Icon of vadosware.iovadosware.io
530282 Icon of valmorganoutdoor.comvalmorganoutdoor.com
530283 Icon of valuesuites.com.auvaluesuites.com.au

664862 (+134579)

530284 Icon of vcsaustralia.org.auvcsaustralia.org.au
530285 Icon of venroy.com.auvenroy.com.au

301512 (-228773)

349959 (-180326)

100151 (-430134)

530286 Icon of vera.org.auvera.org.au
530287 Icon of verante.sharepoint.comverante.sharepoint.com

490826 (-39461)

530288 Icon of vetsupply.com.auvetsupply.com.au

163396 (-366892)

187153 (-343135)

138899 (-391389)

530289 Icon of viclegalaid.sharepoint.comviclegalaid.sharepoint.com

571775 (+41486)

349960 (-180329)

530290 Icon of victoriassecretbeauty.com.auvictoriassecretbeauty.com.au

269894 (-260396)

571778 (+41488)

530291 Icon of videoguys.com.auvideoguys.com.au

379846 (-150445)

530292 Icon of videozenmasters.comvideozenmasters.com
530293 Icon of vidx.onevidx.one

169663 (-360630)

242867 (-287426)

530294 Icon of villageroadshow.com.auvillageroadshow.com.au
530295 Icon of vineasx.comvineasx.com

661245 (+130950)

530296 Icon of vintagenightclublighting.blogspot.comvintagenightclublighting.blogspot.com
530297 Icon of vipfrannet.sharepoint.comvipfrannet.sharepoint.com

503175 (-27122)

571786 (+41489)

574090 (+43793)

530298 Icon of virgilreality.com.auvirgilreality.com.au
530299 Icon of virodeals.comvirodeals.com
530300 Icon of virtualtourscreator.com.auvirtualtourscreator.com.au
530301 Icon of visa.com.auvisa.com.au

599324 (+69023)

530302 Icon of visionabacus.netvisionabacus.net
530303 Icon of visityarravalley.com.auvisityarravalley.com.au

576294 (+45991)

530304 Icon of vitally.comvitally.com
530305 Icon of vlineau.sharepoint.comvlineau.sharepoint.com

574095 (+43790)

530306 Icon of vluxenails.com.auvluxenails.com.au
530307 Icon of vnaya.comvnaya.com

394989 (-135318)

571797 (+41490)

530308 Icon of voipcloud.onlinevoipcloud.online

444336 (-85972)

530309 Icon of voteaustralia.org.auvoteaustralia.org.au
530310 Icon of voyageurs.orgvoyageurs.org
530311 Icon of vwwatercooled.com.auvwwatercooled.com.au

548793 (+18482)

534207 (+3896)

530312 Icon of waca.com.auwaca.com.au

405774 (-124538)

555415 (+25103)

530313 Icon of wallis.com.auwallis.com.au

394998 (-135315)

530314 Icon of warungchefbagus.comwarungchefbagus.com
530315 Icon of waso.com.auwaso.com.au
530316 Icon of waterpik.com.auwaterpik.com.au

503239 (-27077)

530317 Icon of wattlegroveshoppingvillage.com.auwattlegroveshoppingvillage.com.au
530318 Icon of wayandfarer.comwayandfarer.com
530319 Icon of wellingtoninsgroup.comwellingtoninsgroup.com

370987 (-159332)

530320 Icon of westjustice.org.auwestjustice.org.au
530321 Icon of westmeadrehab.net.auwestmeadrehab.net.au
530322 Icon of westpacopenair.com.auwestpacopenair.com.au

530871 (+549)

135747 (-394575)

530323 Icon of wgrlcvicgovau.sharepoint.comwgrlcvicgovau.sharepoint.com

530872 (+549)

530324 Icon of whois.aiwhois.ai

189074 (-341250)

530325 Icon of whola.com.auwhola.com.au

128757 (-401568)

530326 Icon of wildlifecoastcruises.com.auwildlifecoastcruises.com.au
530327 Icon of wildwatersports.com.auwildwatersports.com.au
530328 Icon of williamsshoes.com.auwilliamsshoes.com.au

264790 (-265538)

316030 (-214298)

530329 Icon of willoughbypodiatry.com.auwilloughbypodiatry.com.au
530330 Icon of wilstonpandc.org.auwilstonpandc.org.au
530331 Icon of windchimesaustralia.com.auwindchimesaustralia.com.au
530332 Icon of windgoo.ukwindgoo.uk
530333 Icon of wms2.infowms2.info

385751 (-144582)

599581 (+69248)

574175 (+43842)

530334 Icon of wonderingwhattochoose.comwonderingwhattochoose.com

395015 (-135319)

530335 Icon of woolworthsmoney.com.auwoolworthsmoney.com.au

395018 (-135317)

599608 (+69273)

384990 (-145345)

530336 Icon of workdayspend.comworkdayspend.com
530337 Icon of workingtitlefilms.comworkingtitlefilms.com
530338 Icon of workpac.comworkpac.com

196543 (-333795)

466204 (-64134)

530339 Icon of wrestlekulture.comwrestlekulture.com

353887 (-176452)

490888 (-39451)

530340 Icon of wucc.com.auwucc.com.au
530341 Icon of xirrus.comxirrus.com

612684 (+82343)

530342 Icon of xonelec.comxonelec.com

586272 (+55930)

190318 (-340024)

530343 Icon of xueanquan.comxueanquan.com

9035 (-521308)

3952 (-526391)

530344 Icon of xufile.comxufile.com

405809 (-124535)

530345 Icon of yamaha-motor.com.auyamaha-motor.com.au

106039 (-424306)

530346 Icon of yamahaoemparts.com.auyamahaoemparts.com.au
530347 Icon of yfwholesale.comyfwholesale.com
530348 Icon of ymcapay.comymcapay.com
530349 Icon of youionline.sharepoint.comyouionline.sharepoint.com

490904 (-39445)

530350 Icon of yournextbigmove.com.auyournextbigmove.com.au

480999 (-49351)

530351 Icon of yowcon.comyowcon.com
530352 Icon of yunfulfillment.comyunfulfillment.com
530353 Icon of zamels.com.auzamels.com.au

481005 (-49348)

530354 Icon of zeesy.pkzeesy.pk

385758 (-144596)

456795 (-73559)

530355 Icon of zenexus.com.auzenexus.com.au
530356 Icon of zevercloud.comzevercloud.com

405815 (-124541)

574243 (+43887)

530357 Icon of zimcricketforums.comzimcricketforums.com

530889 (+532)

457307 (-73050)

530358 Icon of zipline.iozipline.io

424355 (-106003)

530359 Icon of puzzgrid.compuzzgrid.com

529243 (-1116)

687202 (+156843)

392717 (-137642)

530360 Icon of angelicoussisgroup.comangelicoussisgroup.com

577438 (+47078)

576971 (+46611)

530361 Icon of chuangba23.xyzchuangba23.xyz
530362 Icon of iamroofa.comiamroofa.com
530363 Icon of imperial.nhs.ukimperial.nhs.uk

113603 (-416760)

185562 (-344801)

530364 Icon of losravelda.comlosravelda.com

323740 (-206624)

530365 Icon of ride-my-bike.inride-my-bike.in
530366 Icon of symphonyoflove.netsymphonyoflove.net

307759 (-222607)

575004 (+44638)

568584 (+38218)

105207 (-425159)

530367 Icon of vikinggear.dkvikinggear.dk

676717 (+146350)

530368 Icon of parasited.comparasited.com

293449 (-236919)

161421 (-368947)

530369 Icon of asgar-ansari0098.myshopify.comasgar-ansari0098.myshopify.com
530370 Icon of babaagynemubolt.hubabaagynemubolt.hu

164718 (-365652)

530371 Icon of biogast.atbiogast.at
530372 Icon of bioniq.combioniq.com
530373 Icon of ceramicarondine.itceramicarondine.it

247023 (-283350)

530374 Icon of digitalcameragraz.atdigitalcameragraz.at
530375 Icon of e9planet.come9planet.com

558351 (+27976)

530376 Icon of electrobuzz.netelectrobuzz.net

283144 (-247232)

426467 (-103909)

143529 (-386847)

17305 (-513071)

530377 Icon of forum-ahnenforschung.euforum-ahnenforschung.eu

534894 (+4517)

615128 (+84751)

576468 (+46091)

530378 Icon of furmanpower.comfurmanpower.com
530379 Icon of growland.netgrowland.net

92347 (-438032)

80388 (-449991)

179047 (-351332)

530380 Icon of hdgoe.athdgoe.at

496454 (-33926)

652012 (+121632)

625256 (+94876)

530381 Icon of heizungsdrache.deheizungsdrache.de

505221 (-25160)

530382 Icon of iso-design.deiso-design.de

213473 (-316909)

530383 Icon of kettlerworldtours.dekettlerworldtours.de

526828 (-3555)

491239 (-39144)

530384 Icon of luminafashion.comluminafashion.com
530385 Icon of naturelook.eunaturelook.eu

609741 (+79356)

571102 (+40717)

530386 Icon of pflegecommunity.atpflegecommunity.at

534761 (+4375)

530387 Icon of podcam.ddns.netpodcam.ddns.net

421927 (-108460)

530388 Icon of servusmarktplatz.comservusmarktplatz.com

626894 (+96506)

600024 (+69636)

530389 Icon of talktics.detalktics.de
530390 Icon of tbwa.attbwa.at

535261 (+4871)

530391 Icon of vrtnicentariva.hrvrtnicentariva.hr
530392 Icon of zoner.dezoner.de
530393 Icon of bngcdn.combngcdn.com

215050 (-315343)

228771 (-301622)

530394 Icon of movemotion.chmovemotion.ch

515312 (-15082)

530395 Icon of nas-johannes-aeppli-3.direct.quickconnect.tonas-johannes-aeppli-3.direct.quickconnect.to
530396 Icon of netim.netnetim.net
530397 Icon of ets2modworld.comets2modworld.com

112456 (-417941)

31047 (-499350)

296026 (-234371)

530398 Icon of bereznikinews.rubereznikinews.ru

644088 (+113690)

530399 Icon of chamsyslighting.comchamsyslighting.com

577153 (+46754)

358482 (-171917)

612897 (+82498)

530400 Icon of dlmate16.xyzdlmate16.xyz

250769 (-279631)

466411 (-63989)

530401 Icon of eesti.eeeesti.ee

159076 (-371325)

112428 (-417973)

173013 (-357388)

322856 (-207545)

530402 Icon of vidhd.sitevidhd.site

110613 (-419789)

127296 (-403106)

530403 Icon of latelleclothing.myshopify.comlatelleclothing.myshopify.com

523160 (-7243)

555578 (+25175)

530404 Icon of 313somerset.com.sg313somerset.com.sg
530405 Icon of abc-cooking.com.sgabc-cooking.com.sg

525957 (-4448)

678778 (+148373)

530406 Icon of ahboy.comahboy.com

515062 (-15344)

554000 (+23594)

656168 (+125762)

530407 Icon of andigitallock.comandigitallock.com

515069 (-15338)

627334 (+96927)

656282 (+125875)

530408 Icon of anjappar.com.sganjappar.com.sg
530409 Icon of arex.or.krarex.or.kr
530410 Icon of astrologyvault.comastrologyvault.com

613543 (+83133)

530411 Icon of beyondthevines.combeyondthevines.com

353223 (-177188)

301539 (-228872)

638678 (+108267)

530412 Icon of bmw-sg.combmw-sg.com

656651 (+126239)

530413 Icon of boontongkee.com.sgboontongkee.com.sg

638700 (+108287)

530414 Icon of byinviteonly.shopbyinviteonly.shop

611016 (+80602)

530415 Icon of cardscitadel.comcardscitadel.com

656374 (+125959)

597315 (+66900)

530416 Icon of caringskin.com.sgcaringskin.com.sg
530417 Icon of carpentrydirect.sgcarpentrydirect.sg

563033 (+32616)

656381 (+125964)

530418 Icon of cashchanger.cocashchanger.co

316687 (-213731)

368428 (-161990)

248228 (-282190)

214550 (-315868)

530419 Icon of centreforcybersecurity.comcentreforcybersecurity.com
530420 Icon of connectnpedu-my.sharepoint.comconnectnpedu-my.sharepoint.com

563265 (+32845)

572133 (+41713)

657032 (+126612)

181651 (-348769)

530421 Icon of ct-888.comct-888.com

496467 (-33954)

656666 (+126245)

530422 Icon of cultjobs.comcultjobs.com

525984 (-4438)

656671 (+126249)

530423 Icon of dintaifung.com.sgdintaifung.com.sg
530424 Icon of dollarbackmortgage.comdollarbackmortgage.com

563496 (+33072)

657305 (+126881)

530425 Icon of dreamcore.com.sgdreamcore.com.sg

310072 (-220353)

530426 Icon of dynacoretech.comdynacoretech.com

496471 (-33955)

627608 (+97182)

384832 (-145594)

181672 (-348754)

530427 Icon of estate.sgestate.sg

657521 (+127094)

530428 Icon of firepathlion.comfirepathlion.com

563843 (+33415)

600291 (+69863)

530429 Icon of fuwell.com.sgfuwell.com.sg

563971 (+33542)

462569 (-67860)

570133 (+39704)

530430 Icon of gamingfreak.ingamingfreak.in

442572 (-87858)

422389 (-108041)

320167 (-210263)

530431 Icon of gaysex69.netgaysex69.net

89027 (-441404)

247683 (-282748)

264512 (-265919)

530432 Icon of govietnamvisa.comgovietnamvisa.com
530433 Icon of grandmercureroxy.com.sggrandmercureroxy.com.sg
530434 Icon of hipvan.comhipvan.com

288745 (-241689)

152667 (-377767)

463783 (-66651)

530435 Icon of huasing.nethuasing.net

611048 (+80613)

530436 Icon of humbleproductions.com.auhumbleproductions.com.au
530437 Icon of iosimo.comiosimo.com

287298 (-243139)

530438 Icon of jinglemom.comjinglemom.com

496484 (-33954)

657971 (+127533)

639177 (+108739)

530439 Icon of keepvideo.orgkeepvideo.org

564810 (+34371)

425986 (-104453)

530440 Icon of kiasuparents.comkiasuparents.com

559463 (+29023)

618052 (+87612)

130362 (-400078)

530441 Icon of kukudm.comkukudm.com

144776 (-385665)

207708 (-322733)

158996 (-371445)

61606 (-468835)

530442 Icon of laminatedoor.com.sglaminatedoor.com.sg

540264 (+9822)

658207 (+127765)

371330 (-159112)

530443 Icon of lofthome.comlofthome.com

515898 (-14545)

618070 (+87627)

530444 Icon of m8pools.orgm8pools.org

379575 (-150869)

658388 (+127944)

530445 Icon of mission-hexa.blogspot.commission-hexa.blogspot.com

316326 (-214119)

530446 Icon of mitsubishielectric.com.sgmitsubishielectric.com.sg

603296 (+72850)

530447 Icon of montessorimaterials.commontessorimaterials.com
530448 Icon of msig.com.sgmsig.com.sg

293105 (-237343)

456928 (-73520)

457721 (-72727)

530449 Icon of munsoon.com.sgmunsoon.com.sg
530450 Icon of mynicehome.gov.sgmynicehome.gov.sg

565463 (+35013)

335188 (-195262)

659248 (+128798)

530451 Icon of mytravelbuzzg.commytravelbuzzg.com

460450 (-70001)

456929 (-73522)

414681 (-115770)

530452 Icon of nanrentiantang-1.comnanrentiantang-1.com

555604 (+25152)

425568 (-104884)

530453 Icon of noahgardencentre.com.sgnoahgardencentre.com.sg

533958 (+3505)

600338 (+69885)

530454 Icon of olanlab.comolanlab.com

311919 (-218535)

333856 (-196598)

530455 Icon of onefarrer.comonefarrer.com

658990 (+128535)

530456 Icon of onmywaysg.comonmywaysg.com

515181 (-15275)

573312 (+42856)

530457 Icon of pacificeshop.compacificeshop.com

515184 (-15273)

252285 (-278172)

530458 Icon of parisilk.comparisilk.com

504521 (-25937)

530459 Icon of payboy.bizpayboy.biz

565824 (+35365)

659129 (+128670)

425572 (-104887)

530460 Icon of perfectyourlife.orgperfectyourlife.org

540467 (+10007)

659163 (+128703)

530461 Icon of perromart.com.sgperromart.com.sg

297841 (-232620)

391976 (-138485)

530462 Icon of pizzahut.com.sgpizzahut.com.sg

293106 (-237356)

134936 (-395526)

424088 (-106374)

110325 (-420137)

530463 Icon of rdasingapore.orgrdasingapore.org

534018 (+3555)

530464 Icon of restaurants.sgrestaurants.sg

540541 (+10077)

659506 (+129042)

215085 (-315379)

530465 Icon of sanctuary-gaming.comsanctuary-gaming.com

566292 (+35827)

447809 (-82656)

421452 (-109013)

530466 Icon of sapgrp.comsapgrp.com

515199 (-15267)

530467 Icon of se18.funse18.fun

659660 (+129193)

660227 (+129760)

530468 Icon of shareit.sgshareit.sg

620602 (+90134)

660337 (+129869)

530469 Icon of starhub.sharepoint.comstarhub.sharepoint.com

566676 (+36207)

618207 (+87738)

530470 Icon of sunwithmoon.com.sgsunwithmoon.com.sg

639686 (+109216)

530471 Icon of super-loco.comsuper-loco.com

386854 (-143617)

530472 Icon of theaterfansmanila.comtheaterfansmanila.com

558559 (+28087)

530473 Icon of tip.com.sgtip.com.sg

567075 (+36602)

560644 (+30171)

530474 Icon of toymana.comtoymana.com

227134 (-303340)

291789 (-238685)

530475 Icon of tradersgps.comtradersgps.com

628442 (+97967)

530476 Icon of tremeritus.nettremeritus.net

515246 (-15230)

287836 (-242640)

463797 (-66679)

530477 Icon of trivago.sgtrivago.sg

343072 (-187405)

531666 (+1189)

639791 (+109314)

530478 Icon of valueinvestingacademyonline.comvalueinvestingacademyonline.com

628483 (+98005)

661192 (+130714)

530479 Icon of vermas.myvermas.my
530480 Icon of vibrantdot.covibrantdot.co
530481 Icon of wakkoqu.comwakkoqu.com
530482 Icon of wildsingapore.comwildsingapore.com

567523 (+37041)

628527 (+98045)

499032 (-31450)

530483 Icon of yfway.comyfway.com

25888 (-504595)

26720 (-503763)

639915 (+109432)

530484 Icon of yummyyummy.sgyummyyummy.sg

530101 (-383)

620757 (+90273)

661566 (+131082)

530485 Icon of bikeexif.combikeexif.com

182663 (-347822)

426992 (-103493)

232886 (-297599)

530486 Icon of sexiwatch.comsexiwatch.com

353064 (-177422)

47103 (-483383)

530487 Icon of smr-yogesh.github.iosmr-yogesh.github.io
530488 Icon of gigplanet.nogigplanet.no

633233 (+102745)

388396 (-142092)

530489 Icon of sjurvaage.comsjurvaage.com
530490 Icon of workwearnorge.noworkwearnorge.no

488861 (-41629)

530491 Icon of shopdirekt.dkshopdirekt.dk

491484 (-39007)

618067 (+87576)

661990 (+131499)

530492 Icon of skabsdesign.dkskabsdesign.dk

593733 (+63241)

616185 (+85693)

530493 Icon of likewize.comlikewize.com

34217 (-496276)

289969 (-240524)

210003 (-320490)

5799 (-524694)

530494 Icon of digitalsilk.comdigitalsilk.com

179366 (-351128)

155865 (-374629)

190733 (-339761)

530495 Icon of shopforyourcause.comshopforyourcause.com

382126 (-148369)

530496 Icon of 450gradi.se450gradi.se

433784 (-96712)

530497 Icon of accounting.peaccounting.pe

557271 (+26774)

622203 (+91706)

249692 (-280805)

530498 Icon of akersbergarevyn.seakersbergarevyn.se
530499 Icon of arriva.guruarriva.guru

622277 (+91778)

571418 (+40919)

530500 Icon of astmaochallergilinjen.seastmaochallergilinjen.se

638297 (+107797)