Alexa Top 387501 – 388000 Most Visited Websites – Most Popular Sites List 2022

Based on data from the Alexa rank, this page reveals the Alexa Top 387501 – 388000 most visited websites. We will be updating this list daily, so you can keep track of all the market shifts and spot changes in user interest.

topbrass-inc.com is the top 387501 – 388000 most visited website in the world in 29/11/2022, who’s rank stayed the same, while the second-placed topclasslms.com stayed the same in the same period. topcu.org also performed well.

Depending on the methodology used, the results can have significant variability. However, having a reasonably accurate list is beneficial to the many use cases these lists can be applied to.

Alexa Top 387501 – 388000 Domain List

Alexa Top 387501 – 388000 Websites Ranking data updated according to the most recent updated in 29/11/2022.

Rank Domain Yesterday Last week Last month Last year
387501 Icon of topbrass-inc.comtopbrass-inc.com
387502 Icon of topclasslms.comtopclasslms.com
387503 Icon of topcu.orgtopcu.org

300154 (-87349)

387504 Icon of topfactoryparts.comtopfactoryparts.com
387505 Icon of tophdgayporn.comtophdgayporn.com

300157 (-87348)

651600 (+264095)

387506 Icon of tophealthmanufacturing.comtophealthmanufacturing.com
387507 Icon of topknobs.comtopknobs.com

286607 (-100900)

569885 (+182378)

387508 Icon of topncaastore.orgtopncaastore.org
387509 Icon of toppickguide.comtoppickguide.com

286610 (-100899)

360309 (-27200)

385107 (-2402)

90443 (-297066)

387510 Icon of topschooljobs.orgtopschooljobs.org

275697 (-111813)

387511 Icon of topshelfwineandspirits.comtopshelfwineandspirits.com

153844 (-233667)

387512 Icon of topsites24.detopsites24.de
387513 Icon of toptenwholesale.comtoptenwholesale.com

136046 (-251467)

285737 (-101776)

387514 Icon of torchenterprise.comtorchenterprise.com
387515 Icon of torrentdownloads.infotorrentdownloads.info
387516 Icon of torrentz2fr.xyztorrentz2fr.xyz

513256 (+125740)

176981 (-210535)

75482 (-312034)

387517 Icon of tosecdev.orgtosecdev.org

483725 (+96208)

569983 (+182466)

387518 Icon of toshiba-drivers.comtoshiba-drivers.com
387519 Icon of totalaccessurgentcare.comtotalaccessurgentcare.com
387520 Icon of totalelement.comtotalelement.com

483740 (+96220)

387521 Icon of totalglow.cototalglow.co
387522 Icon of totalleecase.comtotalleecase.com

569223 (+181701)

387523 Icon of totallyjewishtravel.comtotallyjewishtravel.com

483745 (+96222)

739729 (+352206)

325024 (-62499)

387524 Icon of totalmed.comtotalmed.com

332008 (-55516)

421958 (+34434)

387525 Icon of totalregistration.nettotalregistration.net

42687 (-344838)

387526 Icon of totousaparts.comtotousaparts.com
387527 Icon of tourneau.comtourneau.com

412781 (+25254)

392355 (+4828)

279297 (-108230)

90448 (-297079)

387528 Icon of towerhealthvirtualurgentcare.orgtowerhealthvirtualurgentcare.org
387529 Icon of towingservicegarlandtx.comtowingservicegarlandtx.com

412793 (+25264)

387530 Icon of townecarolinas.comtownecarolinas.com
387531 Icon of townemazda.comtownemazda.com
387532 Icon of towneranimalhealth.comtowneranimalhealth.com
387533 Icon of townnorthmazda.comtownnorthmazda.com

319389 (-68144)

387534 Icon of townofbethlehem.orgtownofbethlehem.org

456444 (+68910)

387535 Icon of townofdauphinisland.orgtownofdauphinisland.org
387536 Icon of townofredingtonbeach.comtownofredingtonbeach.com

483800 (+96264)

387537 Icon of towtrax.nettowtrax.net
387538 Icon of toyhabits.comtoyhabits.com

170906 (-216632)

387539 Icon of toyon-toys.myshopify.comtoyon-toys.myshopify.com
387540 Icon of toyota-gib.comtoyota-gib.com

524712 (+137172)

387541 Icon of toyotaasg.comtoyotaasg.com

300174 (-87367)

387542 Icon of toyotaforklift.comtoyotaforklift.com

220923 (-166619)

419133 (+31591)

387543 Icon of toyotaofanaheim.comtoyotaofanaheim.com
387544 Icon of toyotaofcedarpark.comtoyotaofcedarpark.com

392370 (+4826)

371915 (-15629)

82262 (-305282)

387545 Icon of toyotaofmorristown.comtoyotaofmorristown.com
387546 Icon of toyotaofrichardson.comtoyotaofrichardson.com
387547 Icon of toysus-store-demo.myshopify.comtoysus-store-demo.myshopify.com
387548 Icon of tpservices.comtpservices.com

360335 (-27213)

387549 Icon of tracklementsusa.comtracklementsusa.com
387550 Icon of tractor-part.comtractor-part.com
387551 Icon of tradeonlytoday.comtradeonlytoday.com
387552 Icon of tradeway.comtradeway.com
387553 Icon of tradinginterview.comtradinginterview.com

43026 (-344527)

387554 Icon of traduccionesisekai.blogspot.comtraduccionesisekai.blogspot.com

112405 (-275149)

387555 Icon of traffictravis.comtraffictravis.com

332044 (-55511)

483937 (+96382)

118093 (-269462)

387556 Icon of trailblaze-my.sharepoint.comtrailblaze-my.sharepoint.com

456506 (+68950)

387557 Icon of traildesigns.comtraildesigns.com

422000 (+34443)

387558 Icon of trailgridpro.comtrailgridpro.com
387559 Icon of trainingndt.comtrainingndt.com
387560 Icon of trakersystems-my.sharepoint.comtrakersystems-my.sharepoint.com

483962 (+96402)

387561 Icon of transdep.mntransdep.mn

422011 (+34450)

387562 Icon of transexualsingleschat.comtransexualsingleschat.com

246010 (-141552)

343142 (-44420)

387563 Icon of transfersuperstars.comtransfersuperstars.com
387564 Icon of transformationalmedia.comtransformationalmedia.com

118099 (-269465)

387565 Icon of transgressivexcom.sharepoint.comtransgressivexcom.sharepoint.com

360357 (-27208)

168237 (-219328)

387566 Icon of transitionssc.orgtransitionssc.org
387567 Icon of transnewguinea.orgtransnewguinea.org
387568 Icon of traprockrestaurant.nettraprockrestaurant.net
387569 Icon of travelvisabookings.comtravelvisabookings.com

204114 (-183455)

387570 Icon of travismeadows.comtravismeadows.com
387571 Icon of treadlabs.comtreadlabs.com

570419 (+182848)

387572 Icon of treadly.cotreadly.co

252964 (-134608)

387573 Icon of treasurelillysws.comtreasurelillysws.com
387574 Icon of treasuryvault.comtreasuryvault.com
387575 Icon of treatmyocd.comtreatmyocd.com

160137 (-227438)

211336 (-176239)

86370 (-301205)

158517 (-229058)

387576 Icon of treepl.cotreepl.co

286634 (-100942)

372526 (-15050)

90456 (-297120)

387577 Icon of trejoliecafe.comtrejoliecafe.com
387578 Icon of trekbbs.comtrekbbs.com

226209 (-161369)

422035 (+34457)

387579 Icon of trentleck.comtrentleck.com
387580 Icon of tress-for-us.myshopify.comtress-for-us.myshopify.com
387581 Icon of tresta.comtresta.com

413093 (+25512)

360375 (-27206)

156872 (-230709)

387582 Icon of trevdeliverz.comtrevdeliverz.com

300209 (-87373)

387583 Icon of tri-titans.comtri-titans.com
387584 Icon of trianglebrick.comtrianglebrick.com
387585 Icon of tricentury.banktricentury.bank
387586 Icon of tricolor.comtricolor.com
387587 Icon of trilithstudios.comtrilithstudios.com
387588 Icon of trimejte.myshopify.comtrimejte.myshopify.com
387589 Icon of trinettime.comtrinettime.com
387590 Icon of trinity1848.orgtrinity1848.org

360382 (-27208)

387591 Icon of trinitywallstreet.orgtrinitywallstreet.org
387592 Icon of triumvira.comtriumvira.com
387593 Icon of trkzoot.comtrkzoot.com

392478 (+4885)

387594 Icon of trl.orgtrl.org

484271 (+96677)

422064 (+34470)

129916 (-257678)

387595 Icon of trolleytours.comtrolleytours.com

570642 (+183047)

78395 (-309200)

387596 Icon of tropicairkenya.comtropicairkenya.com
387597 Icon of tru-tone.comtru-tone.com
387598 Icon of trucos.protrucos.pro
387599 Icon of tructiepbongda1.cotructiepbongda1.co
387600 Icon of tructiepbongdax.comtructiepbongdax.com
387601 Icon of trueblocks.iotrueblocks.io
387602 Icon of truedoorpm.comtruedoorpm.com
387603 Icon of truefitness.comtruefitness.com
387604 Icon of truehold.comtruehold.com

158600 (-229004)

387605 Icon of truerangetraders.comtruerangetraders.com
387606 Icon of truetrae.comtruetrae.com
387607 Icon of truewatt.cotruewatt.co

484369 (+96762)

333783 (-53824)

387608 Icon of truewaykids.comtruewaykids.com

176327 (-211281)

484370 (+96762)

337671 (-49937)

387609 Icon of trumpetwarmup.comtrumpetwarmup.com

300232 (-87377)

343167 (-44442)

387610 Icon of truscore.comtruscore.com

484395 (+96785)

385154 (-2456)

387611 Icon of trustarts.orgtrustarts.org

146557 (-241054)

387612 Icon of trustedhealth.comtrustedhealth.com

392513 (+4901)

163499 (-224113)

158630 (-228982)

387613 Icon of trusttree.sharepoint.comtrusttree.sharepoint.com
387614 Icon of trwd.comtrwd.com
387615 Icon of try-oh-snap.myshopify.comtry-oh-snap.myshopify.com

271180 (-116435)

118147 (-269468)

387616 Icon of trygrs.comtrygrs.com
387617 Icon of trygutterwand.comtrygutterwand.com
387618 Icon of trymedia.comtrymedia.com

152641 (-234977)

387619 Icon of trypaddie.comtrypaddie.com
387620 Icon of ts-baileyjay.comts-baileyjay.com

258370 (-129250)

269157 (-118463)

387621 Icon of tscp.comtscp.com

272444 (-115177)

378431 (-9190)

95462 (-292159)

387622 Icon of tstvdates.comtstvdates.com
387623 Icon of ttbonline.govttbonline.gov

413369 (+25746)

570886 (+183263)

387624 Icon of ttking21.mettking21.me
387625 Icon of tuanche.comtuanche.com

133929 (-253696)

387626 Icon of tucker.comtucker.com
387627 Icon of tuepodcast.nettuepodcast.net

413413 (+25786)

387628 Icon of tufext.comtufext.com

347617 (-40011)

422108 (+34480)

387629 Icon of tuitionexchange.orgtuitionexchange.org
387630 Icon of tujidao04.comtujidao04.com

25344 (-362286)

387631 Icon of tulogy.comtulogy.com

158679 (-228952)

387632 Icon of tulsaschools.orgtulsaschools.org

300256 (-87376)

195154 (-192478)

387633 Icon of tunny-saffron-8p7f.squarespace.comtunny-saffron-8p7f.squarespace.com
387634 Icon of turfmobilehomepark.comturfmobilehomepark.com
387635 Icon of turkiyesosyaldemokrat.comturkiyesosyaldemokrat.com
387636 Icon of turkseries.coturkseries.co
387637 Icon of turnkeyisp.coturnkeyisp.co
387638 Icon of turtle-disc-3afc.squarespace.comturtle-disc-3afc.squarespace.com

571046 (+183408)

387639 Icon of turtle-tides.comturtle-tides.com
387640 Icon of tusc.cotusc.co
387641 Icon of tuskegee.edutuskegee.edu

249518 (-138123)

293372 (-94269)

147470 (-240171)

387642 Icon of tvcnet.comtvcnet.com
387643 Icon of tvguidemagazine.comtvguidemagazine.com
387644 Icon of tvlinks.cctvlinks.cc
387645 Icon of tvnara.xyztvnara.xyz

31974 (-355671)

70080 (-317565)

387646 Icon of tvshows88.orgtvshows88.org

70693 (-316953)

323175 (-64471)

121366 (-266280)

387647 Icon of twickenham.orgtwickenham.org
387648 Icon of twincitiesgasprices.comtwincitiesgasprices.com
387649 Icon of twinkl.com.cntwinkl.com.cn

5828 (-381821)

387650 Icon of twinkletwinklelittleone.comtwinkletwinklelittleone.com

484737 (+97087)

387651 Icon of twinkletwinklenightnannyservice.comtwinkletwinklenightnannyservice.com
387652 Icon of twirpx.orgtwirpx.org

285452 (-102200)

387653 Icon of twistedmovement.comtwistedmovement.com
387654 Icon of twistedtea.comtwistedtea.com
387655 Icon of twistmyrubberarm.comtwistmyrubberarm.com

192789 (-194866)

387656 Icon of twixlmedia.comtwixlmedia.com

332233 (-55423)

484763 (+97107)

299548 (-88108)

387657 Icon of two18.comtwo18.com
387658 Icon of twocousinpizza.comtwocousinpizza.com
387659 Icon of twohoosierscyclery.comtwohoosierscyclery.com
387660 Icon of twomenandatruck.comtwomenandatruck.com

332237 (-55423)

252977 (-134683)

203608 (-184052)

387661 Icon of twoseatour.comtwoseatour.com
387662 Icon of tylerportico.comtylerportico.com

332243 (-55419)

133409 (-254253)

103575 (-284087)

387663 Icon of typhoncap.comtyphoncap.com
387664 Icon of tyronega.govtyronega.gov
387665 Icon of tyson.com.cntyson.com.cn
387666 Icon of tzumi.comtzumi.com

456782 (+69116)

387667 Icon of uadplugins.clubuadplugins.club
387668 Icon of uadreams.comuadreams.com

176330 (-211338)

380801 (-6867)

387669 Icon of uams.eduuams.edu

146209 (-241460)

90641 (-297028)

387670 Icon of ubeesize.comubeesize.com
387671 Icon of ubertireplicas.comubertireplicas.com
387672 Icon of ubifcu.comubifcu.com
387673 Icon of ubp.comubp.com
387674 Icon of ucaiyun.comucaiyun.com

360445 (-27229)

131636 (-256038)

387675 Icon of ucc.eduucc.edu

300292 (-87383)

113396 (-274279)

279326 (-108349)

351062 (-36613)

387676 Icon of uchetechs.comuchetechs.com

300295 (-87381)

387677 Icon of ucmbookstore.comucmbookstore.com
387678 Icon of uconnfertility.comuconnfertility.com
387679 Icon of udl-irn.orgudl-irn.org
387680 Icon of ufaa.go.keufaa.go.ke

354251 (-33429)

387681 Icon of ufpso1971.orgufpso1971.org

300305 (-87376)

387682 Icon of ugears.usugears.us

474116 (+86434)

387683 Icon of uhcdental.comuhcdental.com

286674 (-101009)

360457 (-27226)

93688 (-293995)

387684 Icon of uhdowntown-my.sharepoint.comuhdowntown-my.sharepoint.com

252983 (-134701)

337698 (-49986)

387685 Icon of uibm.gov.ituibm.gov.it

366457 (-21228)

308180 (-79505)

171805 (-215880)

387686 Icon of uihealthcare.comuihealthcare.com

256144 (-131542)

343214 (-44472)

346355 (-41331)

387687 Icon of uihere.comuihere.com

294207 (-93480)

387688 Icon of uitinstitute.comuitinstitute.com
387689 Icon of ukfcu.orgukfcu.org

332274 (-55415)

254241 (-133448)

387690 Icon of ukofgbe.orgukofgbe.org

484945 (+97255)

387691 Icon of ukweedfarm.comukweedfarm.com
387692 Icon of ulh.orgulh.org
387693 Icon of ullmanbursa.sharepoint.comullmanbursa.sharepoint.com
387694 Icon of ultabeauty.comultabeauty.com

360465 (-27229)

387695 Icon of ultimatedoghealth.comultimatedoghealth.com
387696 Icon of umanitoba-my.sharepoint.comumanitoba-my.sharepoint.com

422191 (+34495)

205379 (-182317)

387697 Icon of umassmemorial.orgumassmemorial.org

188196 (-199501)

296422 (-91275)

422194 (+34497)

103449 (-284248)

387698 Icon of umonitor.comumonitor.com

354055 (-33643)

387699 Icon of unatampabay.orgunatampabay.org
387700 Icon of unbounded.orgunbounded.org
387701 Icon of uncarts-my.sharepoint.comuncarts-my.sharepoint.com

422202 (+34501)

387702 Icon of unchainedlabs.comunchainedlabs.com
387703 Icon of uncletetsu-us.comuncletetsu-us.com
387704 Icon of undeathmetal.comundeathmetal.com
387705 Icon of underarmour.sharepoint.comunderarmour.sharepoint.com

571591 (+183886)

387706 Icon of underprotection.co.ukunderprotection.co.uk
387707 Icon of underthebough.comunderthebough.com
387708 Icon of unfilteredwithkiran.comunfilteredwithkiran.com

118398 (-269310)

299557 (-88151)

387709 Icon of unfospreys.comunfospreys.com
387710 Icon of uniabuja.edu.nguniabuja.edu.ng
387711 Icon of unifiedlife.comunifiedlife.com
387712 Icon of unigiants.comunigiants.com
387713 Icon of unimedrio.com.brunimedrio.com.br

106727 (-280986)

387714 Icon of unionadorbs.comunionadorbs.com
387715 Icon of uniq.cxuniq.cx

441242 (+53527)

387716 Icon of united-imaging.comunited-imaging.com

571701 (+183985)

387717 Icon of united-monograms.comunited-monograms.com

272474 (-115243)

387718 Icon of unitedamerican.comunitedamerican.com

300332 (-87386)

485146 (+97428)

387719 Icon of unitedfrontlinetable.orgunitedfrontlinetable.org
387720 Icon of unitedphilforum.orgunitedphilforum.org
387721 Icon of unitedsabaeansworldwide.comunitedsabaeansworldwide.com
387722 Icon of unitedstatesinsurance.comunitedstatesinsurance.com

483846 (+96124)

211355 (-176367)

202431 (-185291)

387723 Icon of unityinthecommunitypa.comunityinthecommunitypa.com

286686 (-101037)

387724 Icon of universalathletic.comuniversalathletic.com
387725 Icon of universalgreengroup.comuniversalgreengroup.com
387726 Icon of universalparksnewstoday.comuniversalparksnewstoday.com

222787 (-164939)

387727 Icon of universalss.comuniversalss.com
387728 Icon of universitycityhousing.comuniversitycityhousing.com
387729 Icon of universitycoop.comuniversitycoop.com
387730 Icon of universityurologyfl.comuniversityurologyfl.com
387731 Icon of univstats.comunivstats.com

413955 (+26224)

189262 (-198469)

180000 (-207731)

387732 Icon of unlockmaker.comunlockmaker.com

559241 (+171509)

435974 (+48242)

387733 Icon of unlu.edu.arunlu.edu.ar

385199 (-2534)

387734 Icon of unremot.comunremot.com

485246 (+97512)

571824 (+184090)

387735 Icon of unybrands.comunybrands.com

461571 (+73836)

158915 (-228820)

387736 Icon of upaws.orgupaws.org

315125 (-72611)

387737 Icon of upikebears.comupikebears.com

332332 (-55405)

387738 Icon of uplisting.iouplisting.io

300350 (-87388)

422260 (+34522)

118277 (-269461)

387739 Icon of uppababy.comuppababy.com

246613 (-141126)

224129 (-163610)

163290 (-224449)

387740 Icon of upperhand.ioupperhand.io

385203 (-2537)

387741 Icon of uprootteas.comuprootteas.com
387742 Icon of upstartboardgamer.comupstartboardgamer.com
387743 Icon of upstreamtechnologies.usupstreamtechnologies.us
387744 Icon of upswing.ioupswing.io

414073 (+26329)

144709 (-243035)

387745 Icon of ural-motorcycles.squarespace.comural-motorcycles.squarespace.com
387746 Icon of urduvoa.comurduvoa.com

414104 (+26358)

518051 (+130305)

387747 Icon of urgent.lyurgent.ly

252992 (-134755)

422268 (+34521)

387748 Icon of ursinus.eduursinus.edu

176333 (-211415)

250398 (-137350)

387749 Icon of usa-trailer.comusa-trailer.com

286700 (-101049)

387750 Icon of usacandywholesale.comusacandywholesale.com
387751 Icon of usafundingapplications.orgusafundingapplications.org

225070 (-162681)

387752 Icon of usahealthquotes.orgusahealthquotes.org
387753 Icon of usamedshop.comusamedshop.com
387754 Icon of usastrap.comusastrap.com

485449 (+97695)

572046 (+184292)

387755 Icon of usaviationacademy.comusaviationacademy.com

211359 (-176396)

387756 Icon of usbcbowlingstore.comusbcbowlingstore.com

422290 (+34534)

387757 Icon of uscbinc.comuscbinc.com

398444 (+10687)

387758 Icon of uschecomrnd.netuschecomrnd.net
387759 Icon of uscproshop.comuscproshop.com
387760 Icon of usd-rates.comusd-rates.com
387761 Icon of usdirectory.comusdirectory.com
387762 Icon of usedcardboardboxes.comusedcardboardboxes.com

343263 (-44499)

378479 (-9283)

387763 Icon of usedcubicles.comusedcubicles.com
387764 Icon of usfamilysavings.comusfamilysavings.com
387765 Icon of usfk.milusfk.mil

272489 (-115276)

387766 Icon of usg.comusg.com

332377 (-55389)

148649 (-239117)

387767 Icon of usjedu-my.sharepoint.comusjedu-my.sharepoint.com

422298 (+34531)

387768 Icon of usjerseys.cousjerseys.co

414202 (+26434)

387769 Icon of uslsoccer.comuslsoccer.com

422300 (+34531)

387770 Icon of usm.clusm.cl

95716 (-292054)

51797 (-335973)

387771 Icon of usmarriagelaws.comusmarriagelaws.com
387772 Icon of uspostcompany.comuspostcompany.com
387773 Icon of uspsa.orguspsa.org
387774 Icon of ussco.comussco.com

225076 (-162698)

457025 (+69251)

387775 Icon of ustaxdata.comustaxdata.com

304867 (-82908)

387776 Icon of utbb.netutbb.net
387777 Icon of utdcomets.comutdcomets.com
387778 Icon of utheory.comutheory.com

572212 (+184434)

387779 Icon of uthproductions.comuthproductions.com
387780 Icon of uthrive.clubuthrive.club
387781 Icon of utilitybillingsystem.netutilitybillingsystem.net

215782 (-171999)

387782 Icon of uvu365-my.sharepoint.comuvu365-my.sharepoint.com

300383 (-87399)

137340 (-250442)

387783 Icon of uvxy.prouvxy.pro
387784 Icon of uxoptics.comuxoptics.com
387785 Icon of uyennguyen.netuyennguyen.net
387786 Icon of v3locity.comv3locity.com

204961 (-182825)

387787 Icon of va-drivercourses.comva-drivercourses.com
387788 Icon of vac-u-lock.comvac-u-lock.com
387789 Icon of vacall.comvacall.com
387790 Icon of vacshop.com.auvacshop.com.au

466136 (+78346)

387791 Icon of vafamd.comvafamd.com
387792 Icon of vagrades.comvagrades.com
387793 Icon of valderramas.co.ukvalderramas.co.uk
387794 Icon of valeparkah.comvaleparkah.com
387795 Icon of valhalla.venturesvalhalla.ventures

103483 (-284312)

387796 Icon of valkyrieshockey.orgvalkyrieshockey.org
387797 Icon of valleyhope.orgvalleyhope.org
387798 Icon of valleymed.orgvalleymed.org

293399 (-94399)

146118 (-241680)

387799 Icon of valleymillscorn.comvalleymillscorn.com
387800 Icon of valorpaytech.comvalorpaytech.com

422330 (+34530)

387801 Icon of valuehearing.com.auvaluehearing.com.au

485766 (+97965)

387802 Icon of vampr.mevampr.me

43724 (-344078)

387803 Icon of vannuyskia.comvannuyskia.com
387804 Icon of vapemantech.comvapemantech.com

485829 (+98025)

387805 Icon of vapeworld-store.myshopify.comvapeworld-store.myshopify.com

360574 (-27231)

385237 (-2568)

387806 Icon of varietyinsight.comvarietyinsight.com

309060 (-78746)

387807 Icon of vastucreations.comvastucreations.com
387808 Icon of vault.comvault.com

211366 (-176442)

572508 (+184700)

57835 (-329973)

387809 Icon of vbsenterprise.comvbsenterprise.com

213397 (-174412)

387810 Icon of vcientertainment.comvcientertainment.com
387811 Icon of vcn.bc.cavcn.bc.ca

438248 (+50437)

387812 Icon of vcu-online-v4.duckdns.orgvcu-online-v4.duckdns.org
387813 Icon of vdmthelabel.com.auvdmthelabel.com.au

503707 (+115894)

599869 (+212056)

387814 Icon of vectorconnect.comvectorconnect.com

315159 (-72655)

387815 Icon of vectorloo.comvectorloo.com

310234 (-77581)

387816 Icon of veganforum.orgveganforum.org
387817 Icon of vehicleforgood.comvehicleforgood.com
387818 Icon of vehiclevirals.comvehiclevirals.com

414540 (+26722)

223691 (-164127)

387819 Icon of vela.carevela.care

332470 (-55349)

360590 (-27229)

422366 (+34547)

387820 Icon of veliyathgarden.comveliyathgarden.com
387821 Icon of velocicast.iovelocicast.io

112449 (-275372)

180004 (-207817)

387822 Icon of velocitycloud.netvelocitycloud.net

392889 (+5067)

387823 Icon of venalmorrazo.comvenalmorrazo.com
387824 Icon of vendingtracker.comvendingtracker.com

500317 (+112493)

387825 Icon of vendocommerce.comvendocommerce.com

422371 (+34546)

387826 Icon of vendor.companyvendor.company

152541 (-235285)

387827 Icon of venturayachtclub.orgventurayachtclub.org
387828 Icon of venusgroup.comvenusgroup.com
387829 Icon of veracrypt.euveracrypt.eu
387830 Icon of verasbridals.comverasbridals.com
387831 Icon of vericle.comvericle.com

160150 (-227681)

211372 (-176459)

387832 Icon of verint.comverint.com

95394 (-292438)

138232 (-249600)

355222 (-32610)

387833 Icon of veritaspub.comveritaspub.com

300431 (-87402)

610452 (+222619)

387834 Icon of veriteorg.sharepoint.comveriteorg.sharepoint.com
387835 Icon of veritonevoice.comveritonevoice.com
387836 Icon of vermeilingold.jpvermeilingold.jp
387837 Icon of vermontfederal-onlinebanking.orgvermontfederal-onlinebanking.org

211373 (-176464)

422385 (+34548)

387838 Icon of vermontnutfree.comvermontnutfree.com

286731 (-101107)

387839 Icon of verobeachhotelandspa.comverobeachhotelandspa.com
387840 Icon of verowomencare.comverowomencare.com

414629 (+26789)

290053 (-97787)

387841 Icon of versacethotty.tumblr.comversacethotty.tumblr.com
387842 Icon of versaclimber.comversaclimber.com
387843 Icon of versique-my.sharepoint.comversique-my.sharepoint.com
387844 Icon of versique.sharepoint.comversique.sharepoint.com
387845 Icon of versium.comversium.com
387846 Icon of vertshock.comvertshock.com
387847 Icon of veslink.comveslink.com
387848 Icon of vetcoclinics.comvetcoclinics.com

197727 (-190121)

422393 (+34545)

387849 Icon of vetconnectplus.comvetconnectplus.com

85699 (-302150)

103151 (-284698)

387850 Icon of vetniquelabs.comvetniquelabs.com
387851 Icon of vetopropac.comvetopropac.com

461606 (+73755)

387852 Icon of vetsource.comvetsource.com

343309 (-44543)

572794 (+184942)

387853 Icon of vetspire.comvetspire.com

98113 (-289740)

161884 (-225969)

101887 (-285966)

387854 Icon of vettechguide.orgvettechguide.org
387855 Icon of vhostgo.comvhostgo.com

18009 (-369846)

20298 (-367557)

387856 Icon of viantinc.comviantinc.com

486122 (+98266)

126097 (-261759)

387857 Icon of vichy.com.covichy.com.co
387858 Icon of vicioussyndicate.comvicioussyndicate.com

351919 (-35939)

125228 (-262630)

205696 (-182162)

387859 Icon of vickyupdate.comvickyupdate.com

332517 (-55342)

88436 (-299423)

387860 Icon of victoriacollege.eduvictoriacollege.edu

332518 (-55342)

318621 (-69239)

387861 Icon of victorias.net.auvictorias.net.au
387862 Icon of vidafitness.comvidafitness.com
387863 Icon of vidbot.aividbot.ai

56930 (-330933)

486166 (+98303)

97908 (-289955)

387864 Icon of video-animation-service.comvideo-animation-service.com
387865 Icon of videosdemadura.comvideosdemadura.com
387866 Icon of viderspace.comviderspace.com
387867 Icon of vidkreate.comvidkreate.com
387868 Icon of vidkreate.iovidkreate.io
387869 Icon of vidtoon.comvidtoon.com

260640 (-127229)

387870 Icon of viet-studies.comviet-studies.com

332534 (-55336)

360622 (-27248)

457243 (+69373)

387871 Icon of view-my-account.comview-my-account.com
387872 Icon of viewhudforeclosures.comviewhudforeclosures.com

300452 (-87420)

360623 (-27249)

387873 Icon of viewpost.comviewpost.com
387874 Icon of vigneto.invigneto.in
387875 Icon of vigoauto.comvigoauto.com

315177 (-72698)

378508 (-9367)

387876 Icon of vikingcabin.comvikingcabin.com

162370 (-225506)

387877 Icon of villadelpalmar.comvilladelpalmar.com
387878 Icon of villagecapital.comvillagecapital.com
387879 Icon of villagesatlynxcreek.comvillagesatlynxcreek.com
387880 Icon of villagesussex.orgvillagesussex.org
387881 Icon of villagetheatre.orgvillagetheatre.org

343330 (-44551)

387882 Icon of villamontessori.comvillamontessori.com
387883 Icon of ville-pontoise.frville-pontoise.fr
387884 Icon of vin.dynalias.comvin.dynalias.com

256251 (-131633)

387885 Icon of vincentscorner.comvincentscorner.com
387886 Icon of vincenzosplate.comvincenzosplate.com

414858 (+26972)

338905 (-48981)

291916 (-95970)

387887 Icon of viniyoga.comviniyoga.com
387888 Icon of vinnews.comvinnews.com

248620 (-139268)

75832 (-312056)

81163 (-306725)

387889 Icon of vintagehifinut.comvintagehifinut.com
387890 Icon of vintageknittingpatternarchive.comvintageknittingpatternarchive.com
387891 Icon of vintagesoccerjersey.comvintagesoccerjersey.com
387892 Icon of vintagexxx.netvintagexxx.net

486321 (+98429)

387893 Icon of vinylfloors.comvinylfloors.com
387894 Icon of vinylify.comvinylify.com

549823 (+161929)

339239 (-48655)

387895 Icon of violinonline.comviolinonline.com
387896 Icon of viotek.comviotek.com

34196 (-353700)

387897 Icon of vipcollision.comvipcollision.com
387898 Icon of vipdeskjobs.comvipdeskjobs.com
387899 Icon of viprtech.comviprtech.com
387900 Icon of viralitycontent.comviralitycontent.com
387901 Icon of virtru.comvirtru.com

47756 (-340145)

147503 (-240398)

58452 (-329449)

103531 (-284370)

387902 Icon of virtualclaimsadjuster.comvirtualclaimsadjuster.com

286750 (-101152)

247030 (-140872)

385277 (-2625)

351380 (-36522)

387903 Icon of virtuix.comvirtuix.com

311564 (-76339)

534243 (+146340)

573165 (+185262)

387904 Icon of virtutek-x.comvirtutek-x.com
387905 Icon of visa-immi.comvisa-immi.com
387906 Icon of visionboard.iovisionboard.io

332579 (-55327)

457310 (+69404)

387907 Icon of visionelements.comvisionelements.com
387908 Icon of visionswithvickie.comvisionswithvickie.com
387909 Icon of visitannapolis.orgvisitannapolis.org
387910 Icon of visitashland.comvisitashland.com
387911 Icon of visitcatalinaisland.comvisitcatalinaisland.com

189655 (-198256)

573222 (+185311)

387912 Icon of visitduluth.comvisitduluth.com
387913 Icon of visitgreengoods.comvisitgreengoods.com

286757 (-101156)

422461 (+34548)

387914 Icon of visithicotexas.comvisithicotexas.com
387915 Icon of visitmaryland.orgvisitmaryland.org
387916 Icon of visitpikeville.comvisitpikeville.com
387917 Icon of visitrhodeisland.comvisitrhodeisland.com

199162 (-188755)

90521 (-297396)

387918 Icon of visitsansimeonca.comvisitsansimeonca.com
387919 Icon of visitvisalia.comvisitvisalia.com
387920 Icon of visive.aivisive.ai
387921 Icon of visualize.comvisualize.com
387922 Icon of vitakruid.nlvitakruid.nl

484043 (+96121)

250522 (-137400)

426198 (+38276)

387923 Icon of vitalselfstorage.comvitalselfstorage.com
387924 Icon of vitalytennant.comvitalytennant.com

246036 (-141888)

282052 (-105872)

387925 Icon of viteey.comviteey.com
387926 Icon of viva-perkele.comviva-perkele.com
387927 Icon of vivadesignstudio.comvivadesignstudio.com
387928 Icon of vivianhoward.comvivianhoward.com

415104 (+27176)

486572 (+98644)

387929 Icon of vividcanine.comvividcanine.com

224349 (-163580)

573344 (+185415)

387930 Icon of vivideyewearusa.comvivideyewearusa.com

422474 (+34544)

387931 Icon of vivinavi.comvivinavi.com

145167 (-242764)

108029 (-279902)

573349 (+185418)

387932 Icon of vixtechnology.comvixtechnology.com

586992 (+199060)

387933 Icon of vizit.comvizit.com

393064 (+5131)

387934 Icon of vizzyio.comvizzyio.com
387935 Icon of vjmcomputers.co.ukvjmcomputers.co.uk
387936 Icon of vkclip.comvkclip.com

415118 (+27182)

248484 (-139452)

736392 (+348456)

387937 Icon of vlxx69.xyzvlxx69.xyz
387938 Icon of vminnovations-my.sharepoint.comvminnovations-my.sharepoint.com

216991 (-170947)

387939 Icon of vocabularypowerplus.comvocabularypowerplus.com
387940 Icon of voicebrew.comvoicebrew.com

573418 (+185478)

387941 Icon of voicepro.ccvoicepro.cc

286863 (-101078)

310698 (-77243)

387942 Icon of voicesforvtkids.orgvoicesforvtkids.org
387943 Icon of voidputters.comvoidputters.com
387944 Icon of volkswagenofcoolsprings.comvolkswagenofcoolsprings.com

190415 (-197529)

387945 Icon of volvo-oc.comvolvo-oc.com

300500 (-87445)

387946 Icon of voulezloux.tumblr.comvoulezloux.tumblr.com
387947 Icon of voyeurdolls.comvoyeurdolls.com

235959 (-151988)

573532 (+185585)

387948 Icon of vseyewear.comvseyewear.com

332638 (-55310)

387949 Icon of vtexcrm.com.brvtexcrm.com.br

272526 (-115423)

304902 (-83047)

318625 (-69324)

387950 Icon of vtoman.comvtoman.com
387951 Icon of vtstatepolice.blogspot.comvtstatepolice.blogspot.com
387952 Icon of vubervaporizers.comvubervaporizers.com
387953 Icon of vulcan7dialer.comvulcan7dialer.com

90713 (-297240)

387954 Icon of vydia.comvydia.com

190731 (-197223)

616524 (+228570)

573630 (+185676)

387955 Icon of vynemedical.comvynemedical.com
387956 Icon of w2w.comw2w.com

127167 (-260789)

343377 (-44579)

385304 (-2652)

387957 Icon of wabicycles.comwabicycles.com

210576 (-177381)

387958 Icon of wagmigame.iowagmigame.io
387959 Icon of wagner.eduwagner.edu

415331 (+27372)

211386 (-176573)

294760 (-93199)

387960 Icon of wahjobgirl.comwahjobgirl.com
387961 Icon of waiakeainc-my.sharepoint.comwaiakeainc-my.sharepoint.com

573679 (+185718)

387962 Icon of waiverfile.comwaiverfile.com
387963 Icon of wakeforestnc.govwakeforestnc.gov

573698 (+185735)

387964 Icon of walfridogarciaart.myshopify.comwalfridogarciaart.myshopify.com
387965 Icon of walkersglobal.comwalkersglobal.com
387966 Icon of wallpops.comwallpops.com

286784 (-101182)

387967 Icon of wally.casawally.casa

486933 (+98966)

387968 Icon of walton.k12.fl.uswalton.k12.fl.us

315203 (-72765)

387969 Icon of waltonfuneralservice.comwaltonfuneralservice.com
387970 Icon of wanderly.uswanderly.us

486961 (+98991)

573773 (+185803)

387971 Icon of wangxu002.comwangxu002.com
387972 Icon of wardrangers.orgwardrangers.org
387973 Icon of warehousediscountgroceries.comwarehousediscountgroceries.com
387974 Icon of warmspringsranch.comwarmspringsranch.com
387975 Icon of warrencountyia.govwarrencountyia.gov
387976 Icon of warsomewizards.comwarsomewizards.com
387977 Icon of was.tlwas.tl
387978 Icon of washcollsports.comwashcollsports.com
387979 Icon of washington-quarters.comwashington-quarters.com

422544 (+34565)

387980 Icon of washingtondcautotransport.comwashingtondcautotransport.com
387981 Icon of washitape.comwashitape.com
387982 Icon of watchpfree.comwatchpfree.com

461650 (+73668)

387983 Icon of watchtradingacademy.comwatchtradingacademy.com

126202 (-261781)

172164 (-215819)

296864 (-91119)

387984 Icon of watchtv.netwatchtv.net

300542 (-87442)

360722 (-27262)

573916 (+185932)

387985 Icon of water-supply-tanks.myshopify.comwater-supply-tanks.myshopify.com
387986 Icon of waterfrontbrands.comwaterfrontbrands.com
387987 Icon of watermans.comwatermans.com
387988 Icon of watkinsfuneralhomes.comwatkinsfuneralhomes.com
387989 Icon of watrust.comwatrust.com

332728 (-55261)

203626 (-184363)

387990 Icon of wattbuy.comwattbuy.com
387991 Icon of waushara.wi.uswaushara.wi.us
387992 Icon of wavedds.netwavedds.net
387993 Icon of waveya.ccwaveya.cc
387994 Icon of waxingbyteea.comwaxingbyteea.com
387995 Icon of wayne.k12.in.uswayne.k12.in.us
387996 Icon of waynespeed.comwaynespeed.com
387997 Icon of wayos.cnwayos.cn

41101 (-346896)

387998 Icon of wbarmory.comwbarmory.com

574018 (+186020)

387999 Icon of wcc.netwcc.net
388000 Icon of wcicloud.comwcicloud.com