Alexa Top 118501 – 119000 Most Visited Websites – Most Popular Sites List 2022

Based on data from the Alexa rank, this page reveals the Alexa Top 118501 – 119000 most visited websites. We will be updating this list daily, so you can keep track of all the market shifts and spot changes in user interest.

puella-magi.net is the top 118501 – 119000 most visited website in the world in 20/12/2022, who’s rank went up, while the second-placed redredirector.com went up in the same period. bowlroll.site also performed well.

Depending on the methodology used, the results can have significant variability. However, having a reasonably accurate list is beneficial to the many use cases these lists can be applied to.

Alexa Top 118501 – 119000 Domain List

Alexa Top 118501 – 119000 Websites Ranking data updated according to the most recent updated in 20/12/2022.

Rank Domain Yesterday Last week Last month Last year
118501 Icon of puella-magi.netpuella-magi.net

224288 (+105787)

277371 (+158870)

558761 (+440260)

118502 Icon of redredirector.comredredirector.com

113431 (-5071)

104895 (-13607)

176267 (+57765)

118503 Icon of bowlroll.sitebowlroll.site

142991 (+24488)

208340 (+89837)

118504 Icon of civilservice.gov.ukcivilservice.gov.uk
118505 Icon of keio.ac.jpkeio.ac.jp

57750 (-60755)

29919 (-88586)

22019 (-96486)

81341 (-37164)

118506 Icon of wavebox.mewavebox.me

165981 (+47475)

118507 Icon of silversea.comsilversea.com

94226 (-24281)

242620 (+124113)

125224 (+6717)

118508 Icon of londonmet.ac.uklondonmet.ac.uk

136524 (+18016)

324677 (+206169)

77434 (-41074)

118509 Icon of botim.mebotim.me

249934 (+131425)

336200 (+217691)

25874 (-92635)

117435 (-1074)

118510 Icon of cardzmania.comcardzmania.com

49160 (-69350)

179580 (+61070)

213364 (+94854)

118511 Icon of thetechbizz.comthetechbizz.com

51329 (-67182)

118512 Icon of toyorigin.comtoyorigin.com
118513 Icon of offspring.co.ukoffspring.co.uk

273859 (+155346)

75647 (-42866)

118514 Icon of 24x7wpsupport.com24x7wpsupport.com

191342 (+72828)

118515 Icon of 7pmnews.com7pmnews.com

139687 (+21172)

75379 (-43136)

118516 Icon of aagmaal.xyzaagmaal.xyz

439312 (+320796)

97848 (-20668)

118517 Icon of acsgbl.comacsgbl.com
118518 Icon of adpackshareclub.comadpackshareclub.com

60842 (-57676)

63228 (-55290)

134756 (+16238)

170784 (+52266)

118519 Icon of adsourcepro.comadsourcepro.com
118520 Icon of adsspider.comadsspider.com

94263 (-24257)

118521 Icon of adtiny.ukadtiny.uk
118522 Icon of adverstic.comadverstic.com

153166 (+34644)

118523 Icon of affle.comaffle.com

78277 (-40246)

118524 Icon of akunssh.netakunssh.net

465568 (+347044)

516082 (+397558)

370507 (+251983)

118525 Icon of alexisinfo.inalexisinfo.in

95717 (-22808)

135373 (+16848)

118526 Icon of allocatesmartly.comallocatesmartly.com

440206 (+321680)

118527 Icon of alphawave-sa.comalphawave-sa.com
118528 Icon of ampcuscyber.comampcuscyber.com

174058 (+55530)

118529 Icon of animixplayworld.comanimixplayworld.com

361097 (+242568)

118530 Icon of aninetwork.inaninetwork.in

94267 (-24263)

72570 (-45960)

160916 (+42386)

118531 Icon of aninfolab.comaninfolab.com

140263 (+21732)

164785 (+46254)

118532 Icon of anytimenutritionist.inanytimenutritionist.in
118533 Icon of appliedroots.comappliedroots.com

515433 (+396900)

116669 (-1864)

118534 Icon of appmojo.inappmojo.in
118535 Icon of area1security.comarea1security.com
118536 Icon of artenginetech.comartenginetech.com
118537 Icon of articlesinsider.comarticlesinsider.com

96085 (-22452)

36545 (-81992)

326678 (+208141)

118538 Icon of ashrishait.orgashrishait.org

106189 (-12349)

73995 (-44543)

256315 (+137777)

118539 Icon of assetplus.inassetplus.in

202763 (+84224)

118540 Icon of atipro.inatipro.in
118541 Icon of autodeclics.comautodeclics.com

374770 (+256229)

516657 (+398116)

110450 (-8091)

118542 Icon of aviationdreamer.comaviationdreamer.com

106190 (-12352)

56252 (-62290)

99517 (-19025)

160941 (+42399)

118543 Icon of avitex.vnavitex.vn
118544 Icon of basicslife.combasicslife.com

391383 (+272839)

135802 (+17258)

149708 (+31164)

118545 Icon of bathla.combathla.com

297372 (+178827)

118546 Icon of beautyation.combeautyation.com
118547 Icon of behzistiardabil.irbehzistiardabil.ir
118548 Icon of benchkart.combenchkart.com

121944 (+3396)

79658 (-38890)

118549 Icon of bestinfo.aebestinfo.ae

107816 (-10733)

118550 Icon of bestsellersnews.combestsellersnews.com

73009 (-45541)

71524 (-47026)

118551 Icon of bholesai.inbholesai.in

132202 (+13651)

58583 (-59968)

118552 Icon of bitraser.combitraser.com

360521 (+241969)

555199 (+436647)

499719 (+381167)

118553 Icon of blogmaza.comblogmaza.com

137961 (+19408)

118554 Icon of bnmusamvad.combnmusamvad.com
118555 Icon of bollywoodlivehd.combollywoodlivehd.com
118556 Icon of boy-london.comboy-london.com
118557 Icon of bramhacorp.inbramhacorp.in

174214 (+55657)

222678 (+104121)

118558 Icon of brandlock.iobrandlock.io

140304 (+21746)

118559 Icon of bsreducational.combsreducational.com
118560 Icon of callboyjobswhatsappnumber.lifecallboyjobswhatsappnumber.life

179134 (+60574)

118561 Icon of campusdunia.co.incampusdunia.co.in
118562 Icon of carclipsupplier.com.aucarclipsupplier.com.au
118563 Icon of carmycar.comcarmycar.com

222819 (+104256)

118564 Icon of ceilingapp.comceilingapp.com
118565 Icon of cheapdelhiescorts.comcheapdelhiescorts.com

97715 (-20850)

118566 Icon of chennaiport.gov.inchennaiport.gov.in

117558 (-1008)

67659 (-50907)

223497 (+104931)

118567 Icon of chickos.chchickos.ch
118568 Icon of choudharylokmunch.inchoudharylokmunch.in

110809 (-7759)

66075 (-52493)

118569 Icon of chromecastappstips.comchromecastappstips.com

505434 (+386865)

379475 (+260906)

76770 (-41799)

118570 Icon of chudaiporn.comchudaiporn.com

140033 (+21463)

174295 (+55725)

118571 Icon of classifiedadsall.comclassifiedadsall.com

75405 (-43166)

137026 (+18455)

126185 (+7614)

118572 Icon of classifiedcity.xyzclassifiedcity.xyz

43528 (-75044)

118573 Icon of clicbrics.comclicbrics.com

179358 (+60785)

63166 (-55407)

90249 (-28324)

118574 Icon of cloutapps.comcloutapps.com
118575 Icon of clubpurnaa.comclubpurnaa.com
118576 Icon of containerchain.co.nzcontainerchain.co.nz

140081 (+21505)

78885 (-39691)

118577 Icon of crazyrank.incrazyrank.in

102237 (-16340)

78889 (-39688)

203334 (+84757)

118578 Icon of creaticityonline.comcreaticityonline.com

258353 (+139775)

118579 Icon of crgroup.comcrgroup.com

294752 (+176173)

118580 Icon of crossack.comcrossack.com
118581 Icon of crowncricketer.comcrowncricketer.com

225548 (+106967)

355762 (+237181)

118582 Icon of crunkthread.comcrunkthread.com

117578 (-1004)

53099 (-65483)

137041 (+18459)

125168 (+6586)

118583 Icon of curatorpcis.comcuratorpcis.com
118584 Icon of curbearth.comcurbearth.com

137044 (+18460)

118585 Icon of deepakwebit.indeepakwebit.in
118586 Icon of dhatriplay.comdhatriplay.com

137048 (+18462)

118587 Icon of digifection.comdigifection.com

106239 (-12348)

102011 (-16576)

134818 (+16231)

123056 (+4469)

118588 Icon of digitalnet99.comdigitalnet99.com

136822 (+18234)

178763 (+60175)

118589 Icon of digitalnomadads.comdigitalnomadads.com

43511 (-75078)

79880 (-38709)

118590 Icon of django-modeltranslation.readthedocs.iodjango-modeltranslation.readthedocs.io
118591 Icon of dnsayurveda.comdnsayurveda.com

77015 (-41576)

118592 Icon of dreamdesigns.net.indreamdesigns.net.in

117628 (-964)

118593 Icon of dstexports.comdstexports.com

180047 (+61454)

118594 Icon of dubnsub.comdubnsub.com

176470 (+57876)

132240 (+13646)

118595 Icon of e-transway.come-transway.com
118596 Icon of easydns.comeasydns.com

290622 (+172026)

184127 (+65531)

118597 Icon of easytolet.ineasytolet.in

96110 (-22487)

43708 (-74889)

118598 Icon of edaakhil.nic.inedaakhil.nic.in

137057 (+18459)

393764 (+275166)

118599 Icon of edunext1.comedunext1.com

162533 (+43934)

118600 Icon of ekmobitech.comekmobitech.com

364022 (+245422)

118601 Icon of elearningstack.comelearningstack.com

174502 (+55901)

118602 Icon of electriciancare.comelectriciancare.com
118603 Icon of elinororganics.comelinororganics.com

161141 (+42538)

118604 Icon of estatesconsignments.comestatesconsignments.com

102270 (-16334)

465046 (+346442)

259700 (+141096)

118605 Icon of etownpanchayat.cometownpanchayat.com
118606 Icon of examhoop.comexamhoop.com

88784 (-29822)

123563 (+4957)

118607 Icon of ezifytech.comezifytech.com
118608 Icon of findy-jobs.iofindy-jobs.io
118609 Icon of firstbud.infirstbud.in

81332 (-37277)

125201 (+6592)

118610 Icon of fitnesstricks.infitnesstricks.in
118611 Icon of flexsmart.proflexsmart.pro

96118 (-22493)

77032 (-41579)

131617 (+13006)

118612 Icon of flote.appflote.app

98426 (-20186)

542282 (+423670)

173509 (+54897)

59891 (-58721)

118613 Icon of forexbot.co.inforexbot.co.in
118614 Icon of freeadcenter.comfreeadcenter.com
118615 Icon of freewebalert.comfreewebalert.com

106290 (-12325)

118616 Icon of fsh.org.infsh.org.in

115710 (-2906)

118617 Icon of fullpotentialtutor.comfullpotentialtutor.com

479342 (+360725)

118618 Icon of gedalalaxmanaraoysrcp.comgedalalaxmanaraoysrcp.com
118619 Icon of getbedtimestories.comgetbedtimestories.com
118620 Icon of geturtrip.comgeturtrip.com

62251 (-56369)

53107 (-65513)

77223 (-41397)

118621 Icon of ghamasaana.comghamasaana.com

106295 (-12326)

81343 (-37278)

174654 (+56033)

118622 Icon of giftdubaionline.comgiftdubaionline.com

162654 (+44032)

127390 (+8768)

118623 Icon of godisgreat.bloggodisgreat.blog
118624 Icon of godmarc.comgodmarc.com

162665 (+44041)

118625 Icon of gologica.comgologica.com

119359 (+734)

118626 Icon of goodleypublicschool.comgoodleypublicschool.com

78917 (-39709)

118627 Icon of govtsarkariyojna.comgovtsarkariyojna.com

126569 (+7942)

97633 (-20994)

118628 Icon of grants-msje.gov.ingrants-msje.gov.in

107975 (-10653)

137107 (+18479)

134918 (+16290)

118629 Icon of greatrockdev.comgreatrockdev.com

117695 (-934)

70013 (-48616)

330302 (+211673)

118630 Icon of greekislandhome.comgreekislandhome.com

137827 (+19197)

174686 (+56056)

118631 Icon of guild.coguild.co

300021 (+181390)

147096 (+28465)

118632 Icon of haldwanilive.comhaldwanilive.com

102296 (-16336)

127878 (+9246)

118633 Icon of happymothersdayquote.comhappymothersdayquote.com
118634 Icon of harprabh.orgharprabh.org
118635 Icon of haryanamedicalcouncil.orgharyanamedicalcouncil.org

137928 (+19293)

118636 Icon of hasgeek.comhasgeek.com

390031 (+271395)

105447 (-13189)

118637 Icon of hipster-inc.comhipster-inc.com

132279 (+13642)

228990 (+110353)

118638 Icon of holdblogging.comholdblogging.com
118639 Icon of hpwebmart.comhpwebmart.com

162727 (+44088)

127402 (+8763)

118640 Icon of hymsoftware.inhymsoftware.in

87352 (-31288)

118641 Icon of i9social.comi9social.com
118642 Icon of identityclasses.comidentityclasses.com

100033 (-18609)

84228 (-34414)

54011 (-64631)

118643 Icon of ignitepad.comignitepad.com

126236 (+7593)

118644 Icon of ijntr.orgijntr.org
118645 Icon of indianembassybaku.inindianembassybaku.in

108129 (-10516)

118646 Icon of indianhypermarket.com.auindianhypermarket.com.au
118647 Icon of indianporncloud.comindianporncloud.com

181622 (+62975)

118648 Icon of infoknocks.cominfoknocks.com
118649 Icon of infusionnotes.xyzinfusionnotes.xyz

90978 (-27671)

118650 Icon of innominds.cominnominds.com

77353 (-41297)

118651 Icon of innoway.co.ininnoway.co.in
118652 Icon of inventcorp.coinventcorp.co

132289 (+13637)

118653 Icon of irusmac.comirusmac.com
118654 Icon of ittrainingclasses.inittrainingclasses.in

97764 (-20890)

138541 (+19887)

153575 (+34921)

118655 Icon of jaduniv.edu.injaduniv.edu.in

204478 (+85823)

118656 Icon of jigwe.injigwe.in

153582 (+34926)

118657 Icon of jkpwdrb.nic.injkpwdrb.nic.in

140706 (+22049)

448012 (+329355)

118658 Icon of kantilals.comkantilals.com
118659 Icon of karnatakaone.gov.inkarnatakaone.gov.in

59929 (-58730)

97761 (-20898)

78607 (-40052)

55671 (-62988)

118660 Icon of kaushalbharat.gov.inkaushalbharat.gov.in

97763 (-20897)

174932 (+56272)

118661 Icon of khelolelo.comkhelolelo.com

179636 (+60975)

118662 Icon of kissanime24.comkissanime24.com

102330 (-16332)

118663 Icon of koaindia.orgkoaindia.org
118664 Icon of kodo.inkodo.in

110976 (-7688)

262854 (+144190)

118665 Icon of krewgames.comkrewgames.com

262912 (+144247)

118666 Icon of ksp-recruitment.inksp-recruitment.in

100054 (-18612)

129505 (+10839)

118667 Icon of ktron.inktron.in

110981 (-7686)

231276 (+112609)

118668 Icon of kuchsikhe.comkuchsikhe.com
118669 Icon of labd.uslabd.us
118670 Icon of laddu.appladdu.app
118671 Icon of leaclothingco.comleaclothingco.com
118672 Icon of linkbox.prolinkbox.pro

333328 (+214656)

128465 (+9793)

118673 Icon of linkspurt.comlinkspurt.com

263238 (+144565)

161425 (+42752)

118674 Icon of listsforall.comlistsforall.com

363243 (+244569)

118675 Icon of llacademy.orgllacademy.org
118676 Icon of loansandfinance.inloansandfinance.in

89675 (-29001)

118677 Icon of lotusapp.inlotusapp.in
118678 Icon of louzanfashion.comlouzanfashion.com
118679 Icon of maabaglamukhienterprise.commaabaglamukhienterprise.com
118680 Icon of magical-wind.myshopify.commagical-wind.myshopify.com
118681 Icon of maishainfotech.commaishainfotech.com

153661 (+34980)

165561 (+46880)

118682 Icon of meccoimbatore.commeccoimbatore.com

162937 (+44255)

118683 Icon of media.infomedia.info

144560 (+25877)

549174 (+430491)

319528 (+200845)

118684 Icon of mednavigator.commednavigator.com

182672 (+63988)

129839 (+11155)

118685 Icon of microware.inmicroware.in

263901 (+145216)

118686 Icon of mileseeytools.commileseeytools.com

382416 (+263730)

118687 Icon of moisoi.inmoisoi.in
118688 Icon of morthedisha.gov.inmorthedisha.gov.in

171962 (+53274)

118689 Icon of motivehuman.inmotivehuman.in

97871 (-20818)

153702 (+35013)

118690 Icon of motocentral.inmotocentral.in

182868 (+64178)

466914 (+348224)

95579 (-23111)

213698 (+95008)

118691 Icon of movieskid.onlinemovieskid.online

63526 (-55165)

118692 Icon of msmcampuscare.inmsmcampuscare.in
118693 Icon of msmunify.commsmunify.com

106396 (-12297)

79631 (-39062)

179975 (+61282)

118694 Icon of myachievers.org.inmyachievers.org.in

111036 (-7658)

118695 Icon of namanbharat.conamanbharat.co

139715 (+21020)

79715 (-38980)

118696 Icon of nappadori-di.myshopify.comnappadori-di.myshopify.com
118697 Icon of ncrdns.netncrdns.net

102361 (-16336)

63278 (-55419)

140543 (+21846)

118698 Icon of nervedjsmixtapes.comnervedjsmixtapes.com

302324 (+183626)

118699 Icon of neworleansescortsxxx.comneworleansescortsxxx.com
118700 Icon of newsvivs.comnewsvivs.com

135361 (+16661)

118701 Icon of nikshay.innikshay.in

77656 (-41045)

63279 (-55422)

205187 (+86486)

121255 (+2554)

118702 Icon of ntps.nic.inntps.nic.in

72622 (-46080)

118703 Icon of oasisindustries.inoasisindustries.in
118704 Icon of octavstudio.comoctavstudio.com
118705 Icon of odiaquotes.inodiaquotes.in
118706 Icon of officetimer.comofficetimer.com

405630 (+286924)

118707 Icon of onceaday-stockholm.myshopify.comonceaday-stockholm.myshopify.com
118708 Icon of opla.caopla.ca

137216 (+18508)

118709 Icon of opstree.comopstree.com

331134 (+212425)

118710 Icon of ostorlab.coostorlab.co

183459 (+64749)

118711 Icon of pezaas.compezaas.com

132342 (+13631)

118712 Icon of pinksaree.compinksaree.com
118713 Icon of pinsol.mepinsol.me

213570 (+94857)

118714 Icon of placementquestion.complacementquestion.com
118715 Icon of planetigroup.complanetigroup.com

265646 (+146931)

118716 Icon of pleasantescortsmodels11.compleasantescortsmodels11.com

127512 (+8796)

118717 Icon of pleasantviewfarmsinc.compleasantviewfarmsinc.com
118718 Icon of plotsandflats.co.inplotsandflats.co.in

90590 (-28128)

118719 Icon of pngjpl.compngjpl.com

100103 (-18616)

75495 (-43224)

118720 Icon of powerlinx.compowerlinx.com
118721 Icon of prajasakti.comprajasakti.com

77658 (-41063)

64420 (-54301)

44981 (-73740)

118722 Icon of pringleapi.compringleapi.com

94343 (-24379)

77108 (-41614)

123618 (+4896)

165792 (+47070)

118723 Icon of qminsightsblogs.comqminsightsblogs.com
118724 Icon of quantumuniversity.edu.inquantumuniversity.edu.in

153843 (+35119)

70015 (-48709)

118725 Icon of redington.marketredington.market

175484 (+56759)

118726 Icon of redpicasso.comredpicasso.com

97816 (-20910)

123625 (+4899)

118727 Icon of rentokil-pestcontrolindia.comrentokil-pestcontrolindia.com

184131 (+65404)

175496 (+56769)

118728 Icon of researchforecast.comresearchforecast.com

102417 (-16311)

79018 (-39710)

118729 Icon of rivajhome.comrivajhome.com
118730 Icon of rkexam.comrkexam.com

94346 (-24384)

48940 (-69790)

116955 (-1775)

237054 (+118324)

118731 Icon of rmpublicschool.orgrmpublicschool.org
118732 Icon of rtbdemand.comrtbdemand.com
118733 Icon of rubans.inrubans.in

237217 (+118484)

118734 Icon of rupiso.inrupiso.in

118005 (-729)

118735 Icon of sabaidiscuss.comsabaidiscuss.com
118736 Icon of safejointreplacement.comsafejointreplacement.com
118737 Icon of salon.iosalon.io
118738 Icon of sambodhi.co.insambodhi.co.in

98089 (-20649)

118739 Icon of santaliworld.comsantaliworld.com

196568 (+77829)

118740 Icon of sciexperts.comsciexperts.com
118741 Icon of screenworld.itscreenworld.it

234060 (+115319)

137262 (+18521)

118742 Icon of scrollnslide.comscrollnslide.com

267010 (+148268)

118743 Icon of secretsdujeu.comsecretsdujeu.com

128438 (+9695)

4315 (-114428)

118744 Icon of servercart.inservercart.in

88803 (-29941)

58491 (-60253)

45265 (-73479)

118745 Icon of sgcservices.comsgcservices.com

85848 (-32897)

153923 (+35178)

172421 (+53676)

118746 Icon of sharpline.aesharpline.ae
118747 Icon of shrenaa.comshrenaa.com
118748 Icon of shuttle.rsshuttle.rs
118749 Icon of sitaramstationers.comsitaramstationers.com
118750 Icon of skoolcom.inskoolcom.in
118751 Icon of skylarkhomes.inskylarkhomes.in
118752 Icon of slaconsultantsdelhi.inslaconsultantsdelhi.in
118753 Icon of smarttvremoteapp.comsmarttvremoteapp.com
118754 Icon of smmwatch.comsmmwatch.com

61848 (-56906)

118755 Icon of smslucknowbmw.co.insmslucknowbmw.co.in
118756 Icon of snmnaman.orgsnmnaman.org
118757 Icon of soap2dayhd.prosoap2dayhd.pro
118758 Icon of socialcowmedia.comsocialcowmedia.com
118759 Icon of socinvestigation.comsocinvestigation.com
118760 Icon of sofolympiadtrainer.comsofolympiadtrainer.com

175666 (+56906)

118761 Icon of spearboard.comspearboard.com

195834 (+77073)

156058 (+37297)

118762 Icon of spinebiz.comspinebiz.com

267817 (+149055)

118763 Icon of srisubrahmanyaswamydevalayamskandagiri.orgsrisubrahmanyaswamydevalayamskandagiri.org
118764 Icon of srmarblepolishing.comsrmarblepolishing.com

134995 (+16231)

239099 (+120335)

118765 Icon of srsdesigns.insrsdesigns.in
118766 Icon of ssipsraipur.comssipsraipur.com
118767 Icon of stagingathena.azurewebsites.netstagingathena.azurewebsites.net
118768 Icon of star-labs.web.appstar-labs.web.app

111158 (-7610)

118769 Icon of starburstresearch.instarburstresearch.in
118770 Icon of startwin.frstartwin.fr

88807 (-29963)

79042 (-39728)

118771 Icon of statzyreports.comstatzyreports.com

206113 (+87342)

118772 Icon of stellamariscollege.edu.instellamariscollege.edu.in
118773 Icon of sterlingmfgco.co.insterlingmfgco.co.in

267982 (+149209)

118774 Icon of stratospherewebsites.comstratospherewebsites.com

76158 (-42616)

118775 Icon of suncityart.insuncityart.in

131899 (+13124)

118776 Icon of sunshineplacements.insunshineplacements.in
118777 Icon of surreta.comsurreta.com

131902 (+13125)

118778 Icon of sustainable-empowerment.co.uksustainable-empowerment.co.uk
118779 Icon of synergyglobalenterprises.comsynergyglobalenterprises.com
118780 Icon of tamizhvalai.comtamizhvalai.com

77158 (-41622)

74085 (-44695)

127964 (+9184)

129958 (+11178)

118781 Icon of tatanexarc.comtatanexarc.com

268345 (+149564)

118782 Icon of taxivaxi.comtaxivaxi.com

127175 (+8393)

93421 (-25361)

129963 (+11181)

118783 Icon of techcrazy.co.nztechcrazy.co.nz

79055 (-39728)

110828 (-7955)

118784 Icon of techeminds.comtecheminds.com

93773 (-25011)

118785 Icon of techfilx.comtechfilx.com

102461 (-16324)

79056 (-39729)

97475 (-21310)

118786 Icon of techniciansnow.comtechniciansnow.com

106507 (-12279)

96752 (-22034)

129569 (+10783)

138562 (+19776)

118787 Icon of techybois.comtechybois.com

102465 (-16322)

77147 (-41640)

118788 Icon of teenxxx.mobiteenxxx.mobi

113026 (-5762)

118789 Icon of telefonvorwahlen.nettelefonvorwahlen.net

240092 (+121303)

118790 Icon of templaza.nettemplaza.net

492810 (+374020)

118791 Icon of the-spares-company.myshopify.comthe-spares-company.myshopify.com
118792 Icon of thealchemygroup.cothealchemygroup.co

163389 (+44597)

118793 Icon of thechemical.newsthechemical.news
118794 Icon of thedieseldudes.myshopify.comthedieseldudes.myshopify.com
118795 Icon of thegemsfacet.comthegemsfacet.com
118796 Icon of theonlinebeast.comtheonlinebeast.com

79630 (-39166)

118797 Icon of thephotostore.inthephotostore.in

97843 (-20954)

118798 Icon of tianweisignature.comtianweisignature.com

534302 (+415504)

517040 (+398242)

115734 (-3064)

118799 Icon of tifr.res.intifr.res.in

185484 (+66685)

109027 (-9772)

105354 (-13445)

50863 (-67936)

118800 Icon of tirupatitravels.orgtirupatitravels.org
118801 Icon of topcricc.comtopcricc.com
118802 Icon of topshorts.intopshorts.in
118803 Icon of trackwick.comtrackwick.com

135022 (+16219)

118804 Icon of travel4all.intravel4all.in
118805 Icon of travelfoodatlas.comtravelfoodatlas.com

82432 (-36373)

711542 (+592737)

118806 Icon of trendyread.comtrendyread.com

269275 (+150469)

313384 (+194578)

118807 Icon of triforce-inc.comtriforce-inc.com

142130 (+23323)

118808 Icon of trootech.comtrootech.com
118809 Icon of tuoi18.tvtuoi18.tv
118810 Icon of turkishsub.suturkishsub.su
118811 Icon of uksresort.comuksresort.com
118812 Icon of uniqoemedia.comuniqoemedia.com
118813 Icon of upmind.comupmind.com

185778 (+66965)

72179 (-46634)

479195 (+360382)

379961 (+261148)

118814 Icon of upneda.org.inupneda.org.in
118815 Icon of urdupod101.comurdupod101.com
118816 Icon of vierp.invierp.in

70100 (-48716)

172850 (+54034)

118817 Icon of vivekanandaspokenenglish.comvivekanandaspokenenglish.com
118818 Icon of volantetech.comvolantetech.com

382004 (+263186)

118819 Icon of vortexinfoway.comvortexinfoway.com
118820 Icon of vr1sender.comvr1sender.com

97855 (-20965)

118821 Icon of vrspay.invrspay.in

97857 (-20964)

118822 Icon of vull-sport.myshopify.comvull-sport.myshopify.com
118823 Icon of waytoumrah.comwaytoumrah.com

97859 (-20964)

81589 (-37234)

99469 (-19354)

103367 (-15456)

118824 Icon of wcoeapps.inwcoeapps.in

146289 (+27465)

118825 Icon of webpipl.comwebpipl.com

142558 (+23733)

120906 (+2081)

118826 Icon of whytap.inwhytap.in

84530 (-34296)

132416 (+13590)

118827 Icon of wineart24.comwineart24.com
118828 Icon of xnxxvidios.proxnxxvidios.pro

102505 (-16323)

118829 Icon of xvido.clubxvido.club

141929 (+23100)

375110 (+256281)

118830 Icon of xxxvale.comxxxvale.com

186372 (+67542)

118831 Icon of yeshen-web.squarespace.comyeshen-web.squarespace.com

97862 (-20969)

58007 (-60824)

118832 Icon of yogadesk.myshopify.comyogadesk.myshopify.com
118833 Icon of ytviews.inytviews.in

142845 (+24012)

132162 (+13329)

97784 (-21049)

118834 Icon of makler.mdmakler.md

91920 (-26914)

109485 (-9349)

492179 (+373345)

248847 (+130013)

118835 Icon of 720pfilmizletir.com720pfilmizletir.com

161719 (+42884)

92600 (-26235)

370335 (+251500)

135837 (+17002)

118836 Icon of fundingcircle.comfundingcircle.com

198861 (+80025)

85484 (-33352)

118837 Icon of narayanahealth.orgnarayanahealth.org

474810 (+355973)

58713 (-60124)

168720 (+49883)

132677 (+13840)

118838 Icon of sweat.comsweat.com

172538 (+53700)

122836 (+3998)

567676 (+448838)

118839 Icon of deinesexvideos.comdeinesexvideos.com
118840 Icon of edeka.shopedeka.shop
118841 Icon of onlinebook4u.netonlinebook4u.net

589114 (+470273)

118842 Icon of rockabilly-rules.comrockabilly-rules.com

643712 (+524870)

118843 Icon of sexerotischegeschichten.comsexerotischegeschichten.com

521000 (+402157)

253005 (+134162)

118844 Icon of politicheeuropee.gov.itpoliticheeuropee.gov.it

112567 (-6277)

118845 Icon of visualchase.comvisualchase.com

193934 (+75089)

420997 (+302152)

40199 (-78646)

380204 (+261359)

118846 Icon of downloadpcgames6.comdownloadpcgames6.com

87508 (-31338)

67071 (-51775)

63005 (-55841)

60989 (-57857)

118847 Icon of prettymerch.comprettymerch.com

89415 (-29432)

86110 (-32737)

118848 Icon of kejaksaan.go.idkejaksaan.go.id

310150 (+191302)

308119 (+189271)

83142 (-35706)

244776 (+125928)

118849 Icon of jobscore.comjobscore.com

89427 (-29422)

155715 (+36866)

156916 (+38067)

54087 (-64762)

118850 Icon of imgpile.comimgpile.com

65582 (-53268)

392095 (+273245)

147292 (+28442)

73553 (-45297)

118851 Icon of rezi.airezi.ai

359946 (+241095)

48420 (-70431)

114317 (-4534)

302026 (+183175)

118852 Icon of vivastreet.bevivastreet.be

207066 (+88214)

512650 (+393798)

254258 (+135406)

118853 Icon of uiverse.iouiverse.io

33861 (-84992)

265442 (+146589)

94145 (-24708)

118854 Icon of cinema.decinema.de

112715 (-6139)

144888 (+26034)

115460 (-3394)

118855 Icon of magmawiki.commagmawiki.com
118856 Icon of getpublica.comgetpublica.com

102285 (-16571)

71856 (-47000)

166533 (+47677)

112304 (-6552)

118857 Icon of 6yka.com6yka.com

476257 (+357400)

78852 (-40005)

118858 Icon of telegram18hk.comtelegram18hk.com

281360 (+162502)

118859 Icon of lastfm.freetls.fastly.netlastfm.freetls.fastly.net

70321 (-48538)

67933 (-50926)

95312 (-23547)

103893 (-14966)

118860 Icon of lfg.colfg.co

98454 (-20406)

83145 (-35715)

38928 (-79932)

118861 Icon of worldcupdate.comworldcupdate.com
118862 Icon of ikanhm.topikanhm.top

459378 (+340516)

118863 Icon of expedia.co.thexpedia.co.th

178024 (+59161)

115576 (-3287)

199520 (+80657)

118864 Icon of radford.eduradford.edu

128185 (+9321)

70228 (-48636)

65301 (-53563)

175171 (+56307)

118865 Icon of rsuh.rursuh.ru

243623 (+124758)

341541 (+222676)

89818 (-29047)

118866 Icon of uzpesni.ruuzpesni.ru

53282 (-65584)

118867 Icon of onda.maonda.ma

112689 (-6178)

173629 (+54762)

199694 (+80827)

253061 (+134194)

118868 Icon of iir.oneiir.one

341671 (+222803)

95929 (-22939)

118869 Icon of veiled.comveiled.com
118870 Icon of itempurl.comitempurl.com

471405 (+352535)

68688 (-50182)

123434 (+4564)

118871 Icon of altinbas.comaltinbas.com

205468 (+86597)

368431 (+249560)

158954 (+40083)

347418 (+228547)

118872 Icon of oyunyoneticisi.comoyunyoneticisi.com

137123 (+18251)

82493 (-36379)

123158 (+4286)

201932 (+83060)

118873 Icon of crabporn.comcrabporn.com

168337 (+49464)

69653 (-49220)

118874 Icon of a-star.edu.sga-star.edu.sg

162065 (+43191)

232051 (+113177)

222679 (+103805)

118875 Icon of provenexpert.comprovenexpert.com

25224 (-93651)

462208 (+343333)

27490 (-91385)

14249 (-104626)

118876 Icon of crackstreamshd.netcrackstreamshd.net

255614 (+136738)

49195 (-69681)

686860 (+567984)

118877 Icon of neodebrid.comneodebrid.com

49695 (-69182)

91941 (-26936)

84205 (-34672)

276849 (+157972)

118878 Icon of vyprvpn.comvyprvpn.com

22325 (-96553)

75757 (-43121)

276563 (+157685)

218575 (+99697)

118879 Icon of zw-net.comzw-net.com

564385 (+445506)

168343 (+49464)

53899 (-64980)

311563 (+192684)

118880 Icon of instube.cominstube.com

516503 (+397623)

56471 (-62409)

119163 (+283)

118881 Icon of premiumdownload.orgpremiumdownload.org

183822 (+64941)

118882 Icon of legendsofamerica.comlegendsofamerica.com

240926 (+122044)

350804 (+231922)

65785 (-53097)

118883 Icon of sourcebaran.comsourcebaran.com

172063 (+53180)

87952 (-30931)

118884 Icon of oxygenu.xyzoxygenu.xyz

76335 (-42549)

72984 (-45900)

471981 (+353097)

118885 Icon of lululataupe.comlululataupe.com

473014 (+354129)

440735 (+321850)

226971 (+108086)

118886 Icon of dkmgservice.comdkmgservice.com

105036 (-13850)

104687 (-14199)

76313 (-42573)

118887 Icon of exsolution-softs.comexsolution-softs.com

94068 (-24819)

118888 Icon of fieldofbachus.comfieldofbachus.com

175856 (+56968)

345082 (+226194)

579862 (+460974)

88514 (-30374)

118889 Icon of beyondmeat.combeyondmeat.com

173699 (+54810)

236754 (+117865)

327178 (+208289)

118890 Icon of donnerdeal.comdonnerdeal.com

399406 (+280516)

443755 (+324865)

109441 (-9449)

204705 (+85815)

118891 Icon of iseekyoung.comiseekyoung.com

70417 (-48474)

133757 (+14866)

420730 (+301839)

118892 Icon of farposst.rufarposst.ru

118485 (-407)

265338 (+146446)

77294 (-41598)

118893 Icon of augustman.comaugustman.com

219721 (+100828)

233879 (+114986)

218931 (+100038)

118894 Icon of arrs.orgarrs.org

108894 (-10000)

135600 (+16706)

118895 Icon of siamautoshop.co.thsiamautoshop.co.th

106570 (-12325)

113326 (-5569)

118896 Icon of bankmycell.combankmycell.com

476823 (+357927)

208312 (+89416)

118897 Icon of jv.rujv.ru

337741 (+218844)

383380 (+264483)

118898 Icon of webapteka.ruwebapteka.ru

109444 (-9454)

100180 (-18718)

118899 Icon of lalibrairie.comlalibrairie.com

145911 (+27012)

192253 (+73354)

425700 (+306801)

118900 Icon of xporn.toxporn.to

138211 (+19311)

420038 (+301138)

58312 (-60588)

118901 Icon of mruni.eumruni.eu

92690 (-26211)

126051 (+7150)

127006 (+8105)

118902 Icon of acap.com.doacap.com.do

207704 (+88802)

51562 (-67340)

118903 Icon of bavarodigital.netbavarodigital.net

123949 (+5046)

118904 Icon of calle56.comcalle56.com

123950 (+5046)

130400 (+11496)

79172 (-39732)

118905 Icon of easybroker.comeasybroker.com

164581 (+45676)

118906 Icon of jac.com.dojac.com.do
118907 Icon of allwomenstalk.comallwomenstalk.com

137643 (+18736)

100616 (-18291)

114953 (-3954)

57948 (-60959)

118908 Icon of teentubexnxx.comteentubexnxx.com

120740 (+1832)

118909 Icon of banxa.combanxa.com

65174 (-53735)

65906 (-53003)

716045 (+597136)

53248 (-65661)

118910 Icon of smmstone.comsmmstone.com

84850 (-34060)

86133 (-32777)

124228 (+5318)

118911 Icon of adabworld.comadabworld.com

281425 (+162514)

120290 (+1379)

283626 (+164715)

175258 (+56347)

118912 Icon of fengshuirepublic.cofengshuirepublic.co
118913 Icon of fappeninggram.comfappeninggram.com

62235 (-56678)

208550 (+89637)

424214 (+305301)

118914 Icon of waikato.ac.nzwaikato.ac.nz

201911 (+82997)

106330 (-12584)

73402 (-45512)

118915 Icon of amoozeshbin.comamoozeshbin.com

335476 (+216561)

118765 (-150)

398535 (+279620)

118916 Icon of atlasmode.iratlasmode.ir

87472 (-31444)

119730 (+814)

118917 Icon of avanyadak.comavanyadak.com

206573 (+87656)

335815 (+216898)

209413 (+90496)

118918 Icon of avayesunnat.comavayesunnat.com

99248 (-19670)

119731 (+813)

360927 (+242009)

118919 Icon of ayateeshraq.comayateeshraq.com

250498 (+131579)

150990 (+32071)

112084 (-6835)

345077 (+226158)

118920 Icon of bahramshop.irbahramshop.ir

161459 (+42539)

73438 (-45482)

134200 (+15280)

132666 (+13746)

118921 Icon of bahrolfonun.combahrolfonun.com

71215 (-47706)

96769 (-22152)

186394 (+67473)

118922 Icon of blikexb.infoblikexb.info

232891 (+113969)

118923 Icon of bpmtraining.netbpmtraining.net

190448 (+71525)

71997 (-46926)

102125 (-16798)

211018 (+92095)

118924 Icon of cafeerent.comcafeerent.com

134655 (+15731)

104502 (-14422)

319614 (+200690)

118925 Icon of faranice.comfaranice.com
118926 Icon of forever-iran.orgforever-iran.org

324524 (+205598)

337356 (+218430)

118927 Icon of gandishop.comgandishop.com

106823 (-12104)

146157 (+27230)

118928 Icon of gigadoc.irgigadoc.ir

324654 (+205726)

176452 (+57524)

229286 (+110358)

403443 (+284515)

118929 Icon of homeket.cohomeket.co

279331 (+160402)

118930 Icon of kalandt.comkalandt.com

279465 (+160535)

182984 (+64054)

118931 Icon of kanazspid.irkanazspid.ir

196894 (+77963)

99745 (-19186)

315501 (+196570)

118932 Icon of karafarin-insurance.irkarafarin-insurance.ir

279475 (+160543)

102345 (-16587)

182129 (+63197)

118933 Icon of letsgouni.comletsgouni.com

89578 (-29355)

89046 (-29887)

74367 (-44566)

118934 Icon of live-menu.irlive-menu.ir

129922 (+10988)

232779 (+113845)

112104 (-6830)

118935 Icon of mehradhesab.irmehradhesab.ir

222343 (+103408)

118936 Icon of merqc.commerqc.com

86907 (-32029)

49268 (-69668)

120795 (+1859)

118937 Icon of mesbahyazdi.irmesbahyazdi.ir

193293 (+74356)

315551 (+196614)

118938 Icon of phana.irphana.ir

167892 (+48954)

128520 (+9582)

409310 (+290372)

118939 Icon of pioio.compioio.com

87829 (-31110)

340066 (+221127)

146916 (+27977)

205592 (+86653)

118940 Icon of plgroup.complgroup.com

123000 (+4060)

186139 (+67199)

364755 (+245815)

118941 Icon of qom.irqom.ir

109501 (-9440)

232918 (+113977)

132669 (+13728)

118942 Icon of revslider.irrevslider.ir

151074 (+32132)

109574 (-9368)

118943 Icon of takrayan.irtakrayan.ir

190500 (+71557)

130617 (+11674)

295350 (+176407)

118944 Icon of tarhbama.comtarhbama.com

138937 (+19993)

118945 Icon of tehransaz.comtehransaz.com

196335 (+77390)

160140 (+41195)

118946 Icon of vaperegan9.comvaperegan9.com

119929 (+983)

231637 (+112691)

118947 Icon of zaban.storezaban.store

97409 (-21538)

104510 (-14437)

119129 (+182)

323727 (+204780)

118948 Icon of proiezionidiborsa.itproiezionidiborsa.it

142965 (+24017)

237887 (+118939)

72704 (-46244)

252 (-118696)

118949 Icon of allapk.ruallapk.ru

144201 (+25252)

220473 (+101524)

118950 Icon of rgta5.rurgta5.ru

204541 (+85591)

118951 Icon of cardboardconnection.comcardboardconnection.com

60156 (-58795)

60802 (-58149)

100277 (-18674)

55896 (-63055)

118952 Icon of lovethispic.comlovethispic.com

62963 (-55989)

131030 (+12078)

313423 (+194471)

46200 (-72752)

118953 Icon of ufreeporn.orgufreeporn.org

81210 (-37743)

118954 Icon of supercarblondie.comsupercarblondie.com

522690 (+403736)

211097 (+92143)

303039 (+184085)

156578 (+37624)

118955 Icon of inforge.netinforge.net

119118 (+163)

184308 (+65353)

464852 (+345897)

118956 Icon of codesupply.cocodesupply.co

179408 (+60452)

107630 (-11326)

372660 (+253704)

88206 (-30750)

118957 Icon of bd.combd.com

58065 (-60892)

106005 (-12952)

58558 (-60399)

221783 (+102826)

118958 Icon of cozymeal.comcozymeal.com

61137 (-57821)

381023 (+262065)

289688 (+170730)

74938 (-44020)

118959 Icon of thefinancialbrand.comthefinancialbrand.com

310508 (+191549)

111663 (-7296)

80713 (-38246)

118960 Icon of airesoft.co.ukairesoft.co.uk

565979 (+447019)

118961 Icon of telegram-group.orgtelegram-group.org

74465 (-44496)

117608 (-1353)

286334 (+167373)

421308 (+302347)

118962 Icon of verti-search.comverti-search.com

98425 (-20537)

131127 (+12165)

102365 (-16597)

118963 Icon of cuntporntube.comcuntporntube.com

193487 (+74524)

118964 Icon of menudospeques.netmenudospeques.net
118965 Icon of mangakomi.iomangakomi.io

97123 (-21842)

74212 (-44753)

99234 (-19731)

118966 Icon of rayssaguel.comrayssaguel.com

118250 (-716)

128707 (+9741)

118967 Icon of centerviewpartners.comcenterviewpartners.com

504116 (+385149)

320164 (+201197)

522105 (+403138)

118968 Icon of deltapartnersgroup.comdeltapartnersgroup.com
118969 Icon of goasianxxx.comgoasianxxx.com

58582 (-60387)

101728 (-17241)

118970 Icon of healthcare-administration-degree.nethealthcare-administration-degree.net
118971 Icon of moog.commoog.com

549487 (+430516)

363496 (+244525)

549982 (+431011)

118972 Icon of navhindtimes.innavhindtimes.in

218020 (+99048)

572785 (+453813)

145410 (+26438)

118973 Icon of officerecovery.comofficerecovery.com

136327 (+17354)

431548 (+312575)

510444 (+391471)

118974 Icon of ortak.co.ukortak.co.uk
118975 Icon of upload.ccupload.cc

153638 (+34663)

151577 (+32602)

292162 (+173187)

118976 Icon of worldasianp.comworldasianp.com

79967 (-39009)

213665 (+94689)

118977 Icon of littlexgarden.comlittlexgarden.com

79258 (-39719)

84823 (-34154)

86953 (-32024)

118978 Icon of dlkorefa.sitedlkorefa.site

80032 (-38946)

31041 (-87937)

118979 Icon of whistl.co.ukwhistl.co.uk

159191 (+40212)

125704 (+6725)

332879 (+213900)

118980 Icon of dbankcdn.comdbankcdn.com

70659 (-48321)

79551 (-39429)

60280 (-58700)

189273 (+70293)

118981 Icon of romstation.frromstation.fr

69924 (-49057)

106257 (-12724)

70320 (-48661)

118982 Icon of ukrainianwall.comukrainianwall.com

173480 (+54498)

331359 (+212377)

14318 (-104664)

118983 Icon of loopia.seloopia.se

90229 (-28754)

104493 (-14490)

86185 (-32798)

118984 Icon of sahko.tksahko.tk

105044 (-13940)

80529 (-38455)

168854 (+49870)

118985 Icon of sportico.comsportico.com

101421 (-17564)

181248 (+62263)

424135 (+305150)

118986 Icon of mashrou7.commashrou7.com

58983 (-60003)

17032 (-101954)

326709 (+207723)

45561 (-73425)

118987 Icon of factorydirectcraft.comfactorydirectcraft.com

166506 (+47519)

60592 (-58395)

118988 Icon of sextaped.comsextaped.com

277149 (+158161)

307141 (+188153)

165525 (+46537)

118989 Icon of familytherapyxxx.comfamilytherapyxxx.com

86934 (-32055)

128560 (+9571)

171362 (+52373)

118990 Icon of gooten.comgooten.com

520245 (+401255)

105602 (-13388)

68473 (-50517)

18295 (-100695)

118991 Icon of cdkeyz.comcdkeyz.com

171388 (+52397)

145444 (+26453)

118992 Icon of moregameslike.commoregameslike.com

129566 (+10574)

240708 (+121716)

355660 (+236668)

118993 Icon of the-tackle-room.myshopify.comthe-tackle-room.myshopify.com

166538 (+47545)

118994 Icon of clevescene.comclevescene.com

190338 (+71344)

115048 (-3946)

143432 (+24438)

143042 (+24048)

118995 Icon of norway.nonorway.no

142593 (+23598)

526243 (+407248)

159535 (+40540)

393211 (+274216)

118996 Icon of exitosanoticias.peexitosanoticias.pe

123516 (+4520)

123186 (+4190)

118997 Icon of quizbreaker.comquizbreaker.com

238751 (+119754)

256138 (+137141)

134185 (+15188)

118998 Icon of glamourtits.comglamourtits.com

120459 (+1461)

356748 (+237750)

251881 (+132883)

118999 Icon of arcai.comarcai.com

54553 (-64446)

50100 (-68899)

35976 (-83023)

27800 (-91199)

119000 Icon of candypleasure.comcandypleasure.com

333049 (+214049)

334012 (+215012)

317050 (+198050)